Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1038
Gene name
LocationContig_139:33399..33932
Strand-
Gene length (bp)533
Transcript length (bp)480
Coding sequence length (bp)480
Protein length (aa) 160

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16589 BRCT_2 BRCT domain, a BRCA1 C-terminus domain 3.5E-06 45 143

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q920Q2|REV1_MOUSE DNA repair protein REV1 OS=Mus musculus GN=Rev1 PE=1 SV=1 44 138 1.0E-06
sp|Q5R4N7|REV1_PONAB DNA repair protein REV1 OS=Pongo abelii GN=REV1 PE=2 SV=1 44 138 2.0E-06
sp|Q9UBZ9|REV1_HUMAN DNA repair protein REV1 OS=Homo sapiens GN=REV1 PE=1 SV=1 44 138 2.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5905
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4861
Ophiocordyceps australis map64 (Brazil) OphauB2|5291
Ophiocordyceps camponoti-floridani Ophcf2|02068
Ophiocordyceps camponoti-rufipedis Ophun1|1038 (this protein)
Ophiocordyceps kimflemingae Ophio5|8195

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1038
MPPHPPRNAPWPTSSTGHHRAPTRSRPRLPTPLNTQLAPETPPSTAIFAGVVAYIDGSTAPLVSDHRLRSLLVSH
GARLAVRLARSVVTHVLLPPARAGRTALAAAKIEAEGRRRRVAGVRYVDARWVLESVEAGRRLPETRFAAAVGSG
PVLRFGTPG*
Coding >Ophun1|1038
ATGCCCCCCCACCCCCCCCGCAACGCCCCCTGGCCAACCTCGTCAACCGGCCACCACCGCGCCCCCACCCGCTCC
CGCCCCCGACTCCCCACGCCGCTAAACACCCAGCTCGCCCCCGAAACCCCCCCCAGCACCGCCATCTTCGCCGGC
GTCGTCGCCTACATCGACGGCAGCACCGCGCCCCTCGTCTCCGACCACCGCCTCCGCTCCCTCCTCGTCTCCCAC
GGCGCCCGCCTCGCCGTCAGACTCGCCCGCTCCGTCGTCACCCACGTCCTTCTCCCGCCGGCCAGGGCGGGACGC
ACCGCGCTGGCGGCGGCCAAGATTGAGGCTGAGGGGCGGAGGAGACGTGTCGCCGGGGTGCGATACGTCGATGCT
CGCTGGGTGCTTGAGAGTGTCGAGGCGGGCAGGCGGCTTCCGGAGACGCGCTTTGCTGCTGCGGTCGGCTCCGGA
CCCGTCCTGCGCTTCGGAACACCAGGATGA
Transcript >Ophun1|1038
ATGCCCCCCCACCCCCCCCGCAACGCCCCCTGGCCAACCTCGTCAACCGGCCACCACCGCGCCCCCACCCGCTCC
CGCCCCCGACTCCCCACGCCGCTAAACACCCAGCTCGCCCCCGAAACCCCCCCCAGCACCGCCATCTTCGCCGGC
GTCGTCGCCTACATCGACGGCAGCACCGCGCCCCTCGTCTCCGACCACCGCCTCCGCTCCCTCCTCGTCTCCCAC
GGCGCCCGCCTCGCCGTCAGACTCGCCCGCTCCGTCGTCACCCACGTCCTTCTCCCGCCGGCCAGGGCGGGACGC
ACCGCGCTGGCGGCGGCCAAGATTGAGGCTGAGGGGCGGAGGAGACGTGTCGCCGGGGTGCGATACGTCGATGCT
CGCTGGGTGCTTGAGAGTGTCGAGGCGGGCAGGCGGCTTCCGGAGACGCGCTTTGCTGCTGCGGTCGGCTCCGGA
CCCGTCCTGCGCTTCGGAACACCAGGATGA
Gene >Ophun1|1038
ATGCCCCCCCACCCCCCCCGCAACGCCCCCTGGCCAACCTCGTCAACCGGCCACCACCGCGCCCCCACCCGCTCC
CGCCCCCGACTCCCCACGCCGCTAAACACCCAGCTCGCCCCCGAAACCCCCCCCAGCACCGCCATCTTCGCCGGC
GTCGTCGCCTACATCGACGGCAGCACCGCGCCCCTCGTCTCCGACCACCGCCTCCGCTCCCTCCTCGTCTCCCAC
GGCGCCCGCCTCGCCGTCAGACTCGCCCGCTCCGTCGTCACCCACGTCCTTCTCCCGCCGGCCAGGGCGGGACGC
ACCGCGCTGGCGGCGGCCAAGATTGAGGCTGAGGGGCGGAGGAGACGTGTCGCCGGGGTGCGATACGTCGATGCT
CGCTGGTGGGTTCTCTCTCTCTTCCGCTCCATGACGAGACGGCCGCTGACTTGGGGAGGGTGCTTGAGAGTGTCG
AGGCGGGCAGGCGGCTTCCGGAGACGCGCTTTGCTGCTGCGGTCGGCTCCGGACCCGTCCTGCGCTTCGGAACAC
CAGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail