Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1034
Gene name
LocationContig_139:25395..27379
Strand-
Gene length (bp)1984
Transcript length (bp)1818
Coding sequence length (bp)1818
Protein length (aa) 606

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08646 Rep_fac-A_C Replication factor-A C terminal domain 1.7E-54 449 594
PF16900 REPA_OB_2 Replication protein A OB domain 3.1E-37 293 390
PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain 7.3E-22 9 110
PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain 1.5E-09 184 270

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92372|RFA1_SCHPO Replication factor A protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssb1 PE=1 SV=1 6 599 0.0E+00
sp|P22336|RFA1_YEAST Replication factor A protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFA1 PE=1 SV=1 9 596 3.0E-140
sp|P27694|RFA1_HUMAN Replication protein A 70 kDa DNA-binding subunit OS=Homo sapiens GN=RPA1 PE=1 SV=2 9 600 1.0E-137
sp|Q6NY74|RFA1_DANRE Replication protein A 70 kDa DNA-binding subunit OS=Danio rerio GN=rpa1 PE=1 SV=1 9 601 6.0E-137
sp|Q5R7Q4|RFA1_PONAB Replication protein A 70 kDa DNA-binding subunit OS=Pongo abelii GN=RPA1 PE=2 SV=1 9 600 6.0E-134
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92372|RFA1_SCHPO Replication factor A protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssb1 PE=1 SV=1 6 599 0.0E+00
sp|P22336|RFA1_YEAST Replication factor A protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFA1 PE=1 SV=1 9 596 3.0E-140
sp|P27694|RFA1_HUMAN Replication protein A 70 kDa DNA-binding subunit OS=Homo sapiens GN=RPA1 PE=1 SV=2 9 600 1.0E-137
sp|Q6NY74|RFA1_DANRE Replication protein A 70 kDa DNA-binding subunit OS=Danio rerio GN=rpa1 PE=1 SV=1 9 601 6.0E-137
sp|Q5R7Q4|RFA1_PONAB Replication protein A 70 kDa DNA-binding subunit OS=Pongo abelii GN=RPA1 PE=2 SV=1 9 600 6.0E-134
sp|Q8VEE4|RFA1_MOUSE Replication protein A 70 kDa DNA-binding subunit OS=Mus musculus GN=Rpa1 PE=1 SV=1 9 600 4.0E-131
sp|Q01588|RFA1_XENLA Replication protein A 70 kDa DNA-binding subunit OS=Xenopus laevis GN=rpa1 PE=1 SV=1 5 601 7.0E-125
sp|Q5FW17|RFA1_XENTR Replication protein A 70 kDa DNA-binding subunit OS=Xenopus tropicalis GN=rpa1 PE=2 SV=1 5 601 7.0E-124
sp|Q5ZJJ2|RFA1_CHICK Replication protein A 70 kDa DNA-binding subunit OS=Gallus gallus GN=RPA1 PE=2 SV=1 9 600 6.0E-121
sp|Q24492|RFA1_DROME Replication protein A 70 kDa DNA-binding subunit OS=Drosophila melanogaster GN=RpA-70 PE=1 SV=1 7 601 2.0E-119
sp|Q9SKI4|RFA1A_ARATH Replication protein A 70 kDa DNA-binding subunit A OS=Arabidopsis thaliana GN=RPA1A PE=1 SV=1 31 598 2.0E-103
sp|F4JSG3|RFA1E_ARATH Replication protein A 70 kDa DNA-binding subunit E OS=Arabidopsis thaliana GN=RPA1E PE=2 SV=1 8 594 2.0E-98
sp|Q6YZ49|RFA1A_ORYSJ Replication protein A 70 kDa DNA-binding subunit A OS=Oryza sativa subsp. japonica GN=RPA1A PE=1 SV=1 31 600 7.0E-96
sp|Q9FHJ6|RFA1C_ARATH Replication protein A 70 kDa DNA-binding subunit C OS=Arabidopsis thaliana GN=RPA1C PE=3 SV=1 125 603 6.0E-90
sp|Q10Q08|RFA1B_ORYSJ Replication protein A 70 kDa DNA-binding subunit B OS=Oryza sativa subsp. japonica GN=RPA1B PE=1 SV=1 1 601 2.0E-86
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 167 598 1.0E-82
sp|Q9SD82|RFA1B_ARATH Replication protein A 70 kDa DNA-binding subunit B OS=Arabidopsis thaliana GN=RPA1B PE=3 SV=1 6 594 7.0E-75
sp|Q23696|RFA1_CRIFA Replication factor A 51 kDa subunit OS=Crithidia fasciculata GN=RPA1 PE=1 SV=1 166 565 4.0E-69
sp|Q9FME0|RFA1D_ARATH Replication protein A 70 kDa DNA-binding subunit D OS=Arabidopsis thaliana GN=RPA1D PE=2 SV=1 48 605 3.0E-66
sp|O97472|RFA1_CAEBR Probable replication factor A 73 kDa subunit OS=Caenorhabditis briggsae GN=rpa-1 PE=3 SV=1 171 601 2.0E-51
sp|Q19537|RFA1_CAEEL Probable replication factor A 73 kDa subunit OS=Caenorhabditis elegans GN=rpa-1 PE=1 SV=1 92 605 3.0E-49
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 9 131 8.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0003676 nucleic acid binding Yes
GO:0003677 DNA binding Yes
GO:0006260 DNA replication Yes
GO:0097159 organic cyclic compound binding No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006259 DNA metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0043227 membrane-bounded organelle No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0043229 intracellular organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0043226 organelle No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043231 intracellular membrane-bounded organelle No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup821
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4856
Ophiocordyceps australis map64 (Brazil) OphauB2|5297
Ophiocordyceps camponoti-floridani Ophcf2|02064
Ophiocordyceps camponoti-floridani Ophcf2|07426
Ophiocordyceps camponoti-rufipedis Ophun1|1034 (this protein)
Ophiocordyceps kimflemingae Ophio5|1248
Ophiocordyceps subramaniannii Hirsu2|3927

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1034
MAAAAASALSRGSLDAIFNDTDKAAKLFPVPVMQCLQVKKMMPSAQGGDRYRLVMSDGDHYVQTMLATQANHVVQ
EGKLERGCLARVRQYTPNNLKGKNILIILDIEVVESLGVHEKIGEPVAVDSKPATEATIAGSDFYGAKKEETPQP
QVQAPAQSIPTRPAAPSGGNIYPIEGLSPFAHKWTIKARVTVKSDIKTWHKATGEGKLFSVNLLDESGEIRATGF
NDQCDAFYDILQEGSVYFISSPCRVTLAKKQFSNLPNDYELMFERDTVIEKAADQADVPQVRYNFCTISELQAVD
KDSTVDVIGVLKEVGDVSEITSKKDGRPFQKRELTLVDDTGYSVRVTVWGKTASSFEVPADSVVAFKGTKVSDFG
GKSLSLLSSGTMTANPDIPDAHRLKGWYESSGRGGNFATHQGLSTLGGATGRKDEAKTISQVKEENLGVDDTAYY
SIQATIVFIKQDNFCYPACSSQGCNKKVTIQGDGTWLCEKCNVSHDKPNYRYIMSLNVADHSSHQWLSCFDETGN
MIMGKTANELMELKESDDAALVAAFDAVNCKKFAFRCRAKMDNYGDTQRVRYQVMSASVLDFKAEASRLADLIKQ
FDMTS*
Coding >Ophun1|1034
ATGGCGGCCGCCGCAGCATCTGCCCTCTCGAGGGGCTCCCTCGATGCCATCTTCAACGATACCGACAAGGCCGCG
AAGCTGTTCCCCGTTCCTGTCATGCAGTGTCTGCAGGTCAAGAAGATGATGCCCTCTGCTCAGGGCGGGGATCGC
TACCGTCTGGTCATGAGCGATGGCGACCACTACGTTCAGACGATGCTCGCCACCCAGGCCAACCACGTCGTTCAG
GAGGGCAAGCTTGAGCGCGGCTGTCTGGCTCGTGTCAGGCAGTACACGCCCAACAACCTCAAGGGAAAGAACATC
CTCATCATACTCGACATCGAGGTCGTCGAGTCCCTCGGCGTGCACGAAAAGATTGGCGAGCCCGTTGCCGTCGAT
TCCAAGCCCGCTACTGAAGCCACCATCGCCGGCAGCGACTTTTACGGCGCAAAAAAGGAGGAGACGCCCCAGCCG
CAGGTCCAGGCTCCCGCCCAGTCGATCCCCACGCGGCCCGCGGCCCCGTCCGGCGGCAACATCTATCCGATCGAG
GGTCTCTCGCCCTTTGCGCATAAATGGACCATCAAGGCGCGCGTAACGGTCAAGTCGGACATCAAGACGTGGCAC
AAGGCCACAGGCGAGGGCAAGCTCTTTAGCGTCAACCTGCTGGACGAGAGCGGCGAGATCAGGGCCACGGGCTTC
AACGACCAGTGCGACGCCTTTTACGACATCCTCCAGGAGGGCTCCGTCTACTTCATCTCCAGCCCCTGCCGCGTC
ACGCTGGCCAAGAAGCAGTTCTCCAACCTGCCCAACGACTACGAGCTCATGTTTGAGCGCGACACGGTCATTGAA
AAGGCGGCGGATCAGGCAGATGTGCCGCAGGTGCGGTACAACTTTTGCACCATTAGCGAACTACAGGCAGTAGAC
AAGGACAGCACCGTCGACGTCATCGGCGTCCTCAAGGAAGTGGGCGACGTCAGCGAGATCACGTCCAAGAAAGAC
GGCCGGCCGTTCCAGAAGCGGGAGCTGACGCTGGTGGACGACACGGGCTACTCCGTCCGCGTCACGGTCTGGGGC
AAGACGGCCAGCTCGTTTGAAGTGCCAGCCGACTCAGTGGTGGCCTTCAAGGGCACCAAGGTATCCGACTTTGGC
GGCAAGAGCCTCAGCCTGCTGTCTTCGGGCACCATGACGGCAAACCCGGACATCCCCGACGCCCACCGGCTCAAG
GGCTGGTACGAATCCAGCGGACGAGGCGGCAACTTCGCCACGCACCAGGGCCTCTCAACGCTGGGCGGAGCAACG
GGCCGCAAGGACGAAGCCAAGACGATATCCCAAGTCAAGGAGGAGAACCTGGGCGTCGACGACACAGCCTACTAC
TCCATCCAAGCCACCATCGTCTTCATCAAGCAGGACAACTTCTGCTACCCAGCCTGCTCCTCCCAAGGCTGCAAC
AAAAAGGTCACCATCCAAGGCGACGGAACCTGGCTCTGCGAAAAGTGCAACGTCTCGCACGACAAGCCCAACTAC
CGCTACATCATGTCCCTCAACGTCGCCGACCACAGCAGCCACCAATGGCTCAGCTGCTTCGACGAGACGGGCAAC
ATGATCATGGGCAAGACGGCCAATGAGCTTATGGAGCTCAAGGAGAGCGACGACGCCGCGCTGGTGGCTGCCTTT
GACGCCGTCAACTGCAAGAAGTTTGCCTTTCGCTGCAGGGCCAAGATGGATAACTACGGTGATACGCAGAGGGTT
CGCTATCAGGTTATGAGCGCTTCGGTGCTCGACTTCAAAGCTGAGGCGAGTCGGCTGGCGGATCTGATTAAGCAG
TTCGACATGACTTCGTGA
Transcript >Ophun1|1034
ATGGCGGCCGCCGCAGCATCTGCCCTCTCGAGGGGCTCCCTCGATGCCATCTTCAACGATACCGACAAGGCCGCG
AAGCTGTTCCCCGTTCCTGTCATGCAGTGTCTGCAGGTCAAGAAGATGATGCCCTCTGCTCAGGGCGGGGATCGC
TACCGTCTGGTCATGAGCGATGGCGACCACTACGTTCAGACGATGCTCGCCACCCAGGCCAACCACGTCGTTCAG
GAGGGCAAGCTTGAGCGCGGCTGTCTGGCTCGTGTCAGGCAGTACACGCCCAACAACCTCAAGGGAAAGAACATC
CTCATCATACTCGACATCGAGGTCGTCGAGTCCCTCGGCGTGCACGAAAAGATTGGCGAGCCCGTTGCCGTCGAT
TCCAAGCCCGCTACTGAAGCCACCATCGCCGGCAGCGACTTTTACGGCGCAAAAAAGGAGGAGACGCCCCAGCCG
CAGGTCCAGGCTCCCGCCCAGTCGATCCCCACGCGGCCCGCGGCCCCGTCCGGCGGCAACATCTATCCGATCGAG
GGTCTCTCGCCCTTTGCGCATAAATGGACCATCAAGGCGCGCGTAACGGTCAAGTCGGACATCAAGACGTGGCAC
AAGGCCACAGGCGAGGGCAAGCTCTTTAGCGTCAACCTGCTGGACGAGAGCGGCGAGATCAGGGCCACGGGCTTC
AACGACCAGTGCGACGCCTTTTACGACATCCTCCAGGAGGGCTCCGTCTACTTCATCTCCAGCCCCTGCCGCGTC
ACGCTGGCCAAGAAGCAGTTCTCCAACCTGCCCAACGACTACGAGCTCATGTTTGAGCGCGACACGGTCATTGAA
AAGGCGGCGGATCAGGCAGATGTGCCGCAGGTGCGGTACAACTTTTGCACCATTAGCGAACTACAGGCAGTAGAC
AAGGACAGCACCGTCGACGTCATCGGCGTCCTCAAGGAAGTGGGCGACGTCAGCGAGATCACGTCCAAGAAAGAC
GGCCGGCCGTTCCAGAAGCGGGAGCTGACGCTGGTGGACGACACGGGCTACTCCGTCCGCGTCACGGTCTGGGGC
AAGACGGCCAGCTCGTTTGAAGTGCCAGCCGACTCAGTGGTGGCCTTCAAGGGCACCAAGGTATCCGACTTTGGC
GGCAAGAGCCTCAGCCTGCTGTCTTCGGGCACCATGACGGCAAACCCGGACATCCCCGACGCCCACCGGCTCAAG
GGCTGGTACGAATCCAGCGGACGAGGCGGCAACTTCGCCACGCACCAGGGCCTCTCAACGCTGGGCGGAGCAACG
GGCCGCAAGGACGAAGCCAAGACGATATCCCAAGTCAAGGAGGAGAACCTGGGCGTCGACGACACAGCCTACTAC
TCCATCCAAGCCACCATCGTCTTCATCAAGCAGGACAACTTCTGCTACCCAGCCTGCTCCTCCCAAGGCTGCAAC
AAAAAGGTCACCATCCAAGGCGACGGAACCTGGCTCTGCGAAAAGTGCAACGTCTCGCACGACAAGCCCAACTAC
CGCTACATCATGTCCCTCAACGTCGCCGACCACAGCAGCCACCAATGGCTCAGCTGCTTCGACGAGACGGGCAAC
ATGATCATGGGCAAGACGGCCAATGAGCTTATGGAGCTCAAGGAGAGCGACGACGCCGCGCTGGTGGCTGCCTTT
GACGCCGTCAACTGCAAGAAGTTTGCCTTTCGCTGCAGGGCCAAGATGGATAACTACGGTGATACGCAGAGGGTT
CGCTATCAGGTTATGAGCGCTTCGGTGCTCGACTTCAAAGCTGAGGCGAGTCGGCTGGCGGATCTGATTAAGCAG
TTCGACATGACTTCGTGA
Gene >Ophun1|1034
ATGGCGGCCGCCGCAGCATCTGCCCTCTCGAGGGGCTCCCTCGAGTGCGTTCACTGCTGTAGTCTCGTTGCTTTG
CCCCTCAGCTGACGCGTTCCCAGTGCCATCTTCAACGATACCGACAAGGCCGCGAAGCTGTTCCCCGTTCCTGTC
ATGCAGTGTCTGCAGGTCAAGAAGATGATGCCCTCTGCTCAGGGCGGGGATCGCTACCGTCTGGTCATGAGCGAT
GGCGACCACTACGTTCAGACGATGCTCGCCACCCAGGCCAACCACGTCGTTCAGGAGGGCAAGCTTGAGCGCGGC
TGTCTGGCTCGTGTCAGGCAGTACACGCCCAACAACCTCAAGGGAAAGAAGTAAGTCGATTCCCTGTTTGAGGTA
TCCCTCGGCTGCTCACGGTGACGTGTTGCCAGCATCCTCATCATACTCGACATCGAGGTCGTCGAGTCCCTCGGC
GTGCACGAAAAGATTGGCGAGCCCGTTGCCGTCGATTCCAAGCCCGCTACTGAAGCCACCATCGCCGGCAGCGAC
TTTTACGGCGCAAAAAAGGAGGAGACGCCCCAGCCGCAGGTCCAGGCTCCCGCCCAGTCGATCCCCACGCGGCCC
GCGGCCCCGTCCGGCGGCAACATCTATCCGATCGAGGGTCTCTCGCCCTTTGCGCATAAATGGACCATCAAGGCG
CGCGTAACGGTCAAGTCGGACATCAAGACGTGGCACAAGGCCACAGGCGAGGGCAAGCTCTTTAGCGTCAACCTG
CTGGACGAGAGCGGCGAGATCAGGGCCACGGGCTTCAACGACCAGTGCGACGCCTTTTACGACATCCTCCAGGAG
GGCTCCGTCTACTTCATCTCCAGCCCCTGCCGCGTCACGCTGGCCAAGAAGCAGTTCTCCAACCTGCCCAACGAC
TACGAGCTCATGTTTGAGCGCGACACGGTCATTGAAAAGGCGGCGGATCAGGCAGATGTGCCGCAGGTGCGGTAC
AACTTTTGCACCATTAGCGAACTACAGGCAGTAGACAAGGACAGCACCGTCGACGTCATCGGCGTCCTCAAGGAA
GTGGGCGACGTCAGCGAGATCACGTCCAAGAAAGACGGCCGGCCGTTCCAGAAGCGGGAGCTGACGCTGGTGGAC
GACACGGGCTACTCCGTCCGCGTCACGGTCTGGGGCAAGACGGCCAGCTCGTTTGAAGTGCCAGCCGACTCAGTG
GTGGCCTTCAAGGGCACCAAGGTATCCGACTTTGGCGGCAAGAGCCTCAGCCTGCTGTCTTCGGGCACCATGACG
GCAAACCCGGACATCCCCGACGCCCACCGGCTCAAGGGCTGGTACGAATCCAGCGGACGAGGCGGCAACTTCGCC
ACGCACCAGGGCCTCTCAACGCTGGGCGGAGCAACGGGCCGCAAGGACGAAGCCAAGACGATATCCCAAGTCAAG
GAGGAGAACCTGGGCGTCGACGACACAGCCTACTACTCCATCCAAGCCACCATCGTCTTCATCAAGCAGGACAAC
TTCTGCTACCCAGCCTGCTCCTCCCAAGGCTGCAACAAAAAGGTCACCATCCAAGGCGACGGAACCTGGCTCTGC
GAAAAGTGCAACGTCTCGCACGACAAGCCCAACTACCGCTACATCATGTCCCTCAACGTCGCCGACCACAGCAGC
CACCAATGGCTCAGCTGCTTCGACGAGACGGGCAACATGATCATGGGCAAGACGGCCAATGAGCTTATGGAGCTC
AAGGAGAGCGACGACGCCGCGCTGGTGGCTGCCTTTGACGCCGTCAACTGCAAGAAGTTTGCCTTTCGCTGCAGG
GCCAAGATGGATAACTACGGTGATACGCAGAGGTATGCCCCCCTTCGTTGTTGAGATGGTTGGTTGCTGACGGGG
GATGGATGGTAGGGTTCGCTATCAGGTTATGAGCGCTTCGGTGCTCGACTTCAAAGCTGAGGCGAGTCGGCTGGC
GGATCTGATTAAGCAGTTCGACATGACTTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail