© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Ophun1|1033 |
| Gene name | |
| Location | Contig_139:23558..24934 |
| Strand | + |
| Gene length (bp) | 1376 |
| Transcript length (bp) | 1278 |
| Coding sequence length (bp) | 1278 |
| Protein length (aa) | 426 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00171 | Aldedh | Aldehyde dehydrogenase family | 4.1E-15 | 7 | 266 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q9UT44|PROA_SCHPO | Probable gamma-glutamyl phosphate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pro1 PE=3 SV=1 | 7 | 420 | 3.0E-150 |
| sp|P54885|PROA_YEAST | Gamma-glutamyl phosphate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRO2 PE=1 SV=1 | 7 | 425 | 2.0E-125 |
| sp|B0JWW5|PROA_MICAN | Gamma-glutamyl phosphate reductase OS=Microcystis aeruginosa (strain NIES-843) GN=proA PE=3 SV=1 | 1 | 423 | 1.0E-121 |
| sp|Q8DKU1|PROA_THEEB | Gamma-glutamyl phosphate reductase OS=Thermosynechococcus elongatus (strain BP-1) GN=proA PE=3 SV=1 | 22 | 423 | 2.0E-121 |
| sp|Q3MH53|PROA_ANAVT | Gamma-glutamyl phosphate reductase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=proA PE=3 SV=2 | 7 | 421 | 2.0E-119 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q9UT44|PROA_SCHPO | Probable gamma-glutamyl phosphate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pro1 PE=3 SV=1 | 7 | 420 | 3.0E-150 |
| sp|P54885|PROA_YEAST | Gamma-glutamyl phosphate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRO2 PE=1 SV=1 | 7 | 425 | 2.0E-125 |
| sp|B0JWW5|PROA_MICAN | Gamma-glutamyl phosphate reductase OS=Microcystis aeruginosa (strain NIES-843) GN=proA PE=3 SV=1 | 1 | 423 | 1.0E-121 |
| sp|Q8DKU1|PROA_THEEB | Gamma-glutamyl phosphate reductase OS=Thermosynechococcus elongatus (strain BP-1) GN=proA PE=3 SV=1 | 22 | 423 | 2.0E-121 |
| sp|Q3MH53|PROA_ANAVT | Gamma-glutamyl phosphate reductase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=proA PE=3 SV=2 | 7 | 421 | 2.0E-119 |
| sp|Q8YV15|PROA_NOSS1 | Gamma-glutamyl phosphate reductase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=proA PE=3 SV=2 | 7 | 421 | 1.0E-118 |
| sp|P54902|PROA1_SYNY3 | Gamma-glutamyl phosphate reductase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=proA1 PE=3 SV=1 | 11 | 420 | 1.0E-118 |
| sp|B2IZ89|PROA_NOSP7 | Gamma-glutamyl phosphate reductase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=proA PE=3 SV=1 | 11 | 423 | 1.0E-115 |
| sp|B1XLA4|PROA_SYNP2 | Gamma-glutamyl phosphate reductase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=proA PE=3 SV=1 | 10 | 423 | 8.0E-115 |
| sp|B0CFL0|PROA_ACAM1 | Gamma-glutamyl phosphate reductase OS=Acaryochloris marina (strain MBIC 11017) GN=proA PE=3 SV=1 | 1 | 423 | 1.0E-114 |
| sp|C0R0B8|PROA_BRAHW | Gamma-glutamyl phosphate reductase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=proA PE=3 SV=1 | 10 | 423 | 5.0E-114 |
| sp|A5GSH0|PROA_SYNR3 | Gamma-glutamyl phosphate reductase OS=Synechococcus sp. (strain RCC307) GN=proA PE=3 SV=2 | 12 | 425 | 3.0E-113 |
| sp|Q7U654|PROA_SYNPX | Gamma-glutamyl phosphate reductase OS=Synechococcus sp. (strain WH8102) GN=proA PE=3 SV=1 | 12 | 425 | 1.0E-112 |
| sp|A5CZ28|PROA_PELTS | Gamma-glutamyl phosphate reductase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=proA PE=3 SV=1 | 10 | 423 | 5.0E-112 |
| sp|Q0I8Z0|PROA_SYNS3 | Gamma-glutamyl phosphate reductase OS=Synechococcus sp. (strain CC9311) GN=proA PE=3 SV=1 | 11 | 424 | 2.0E-111 |
| sp|A3DC22|PROA_CLOTH | Gamma-glutamyl phosphate reductase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=proA PE=3 SV=1 | 7 | 423 | 9.0E-111 |
| sp|Q5N0Z7|PROA_SYNP6 | Gamma-glutamyl phosphate reductase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=proA PE=3 SV=1 | 22 | 420 | 3.0E-110 |
| sp|Q31KX4|PROA_SYNE7 | Gamma-glutamyl phosphate reductase OS=Synechococcus elongatus (strain PCC 7942) GN=proA PE=3 SV=1 | 22 | 420 | 3.0E-110 |
| sp|Q9HHA1|PROA_METAC | Gamma-glutamyl phosphate reductase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=proA PE=3 SV=1 | 15 | 425 | 9.0E-110 |
| sp|Q112S1|PROA_TRIEI | Gamma-glutamyl phosphate reductase OS=Trichodesmium erythraeum (strain IMS101) GN=proA PE=3 SV=1 | 3 | 421 | 1.0E-109 |
| sp|Q8PYP2|PROA_METMA | Gamma-glutamyl phosphate reductase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=proA PE=3 SV=1 | 15 | 425 | 1.0E-109 |
| sp|Q2JN71|PROA_SYNJB | Gamma-glutamyl phosphate reductase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=proA PE=3 SV=1 | 15 | 420 | 4.0E-109 |
| sp|A5GJS5|PROA_SYNPW | Gamma-glutamyl phosphate reductase OS=Synechococcus sp. (strain WH7803) GN=proA PE=3 SV=1 | 12 | 425 | 7.0E-109 |
| sp|Q7V8C3|PROA_PROMM | Gamma-glutamyl phosphate reductase OS=Prochlorococcus marinus (strain MIT 9313) GN=proA PE=3 SV=1 | 11 | 425 | 8.0E-109 |
| sp|B8HYG3|PROA_CYAP4 | Gamma-glutamyl phosphate reductase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=proA PE=3 SV=1 | 10 | 423 | 1.0E-108 |
| sp|Q46F78|PROA_METBF | Gamma-glutamyl phosphate reductase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=proA PE=3 SV=1 | 8 | 425 | 3.0E-108 |
| sp|A2CAS7|PROA_PROM3 | Gamma-glutamyl phosphate reductase OS=Prochlorococcus marinus (strain MIT 9303) GN=proA PE=3 SV=1 | 11 | 425 | 5.0E-108 |
| sp|B8I6T0|PROA_CLOCE | Gamma-glutamyl phosphate reductase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=proA PE=3 SV=1 | 10 | 423 | 6.0E-107 |
| sp|Q12TF9|PROA_METBU | Gamma-glutamyl phosphate reductase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=proA PE=3 SV=1 | 9 | 423 | 7.0E-107 |
| sp|A2C148|PROA_PROM1 | Gamma-glutamyl phosphate reductase OS=Prochlorococcus marinus (strain NATL1A) GN=proA PE=3 SV=1 | 10 | 425 | 2.0E-105 |
| sp|Q2JQB4|PROA_SYNJA | Gamma-glutamyl phosphate reductase OS=Synechococcus sp. (strain JA-3-3Ab) GN=proA PE=3 SV=1 | 25 | 420 | 7.0E-105 |
| sp|Q46LW0|PROA_PROMT | Gamma-glutamyl phosphate reductase OS=Prochlorococcus marinus (strain NATL2A) GN=proA PE=3 SV=1 | 10 | 425 | 2.0E-104 |
| sp|Q3AYD4|PROA_SYNS9 | Gamma-glutamyl phosphate reductase OS=Synechococcus sp. (strain CC9902) GN=proA PE=3 SV=2 | 12 | 425 | 3.0E-104 |
| sp|Q3AKU8|PROA_SYNSC | Gamma-glutamyl phosphate reductase OS=Synechococcus sp. (strain CC9605) GN=proA PE=3 SV=1 | 30 | 425 | 2.0E-103 |
| sp|Q7VBM1|PROA_PROMA | Gamma-glutamyl phosphate reductase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=proA PE=3 SV=1 | 12 | 420 | 4.0E-103 |
| sp|A3PBW4|PROA_PROM0 | Gamma-glutamyl phosphate reductase OS=Prochlorococcus marinus (strain MIT 9301) GN=proA PE=3 SV=1 | 10 | 423 | 2.0E-102 |
| sp|Q3IP72|PROA_NATPD | Gamma-glutamyl phosphate reductase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=proA PE=3 SV=1 | 14 | 423 | 4.0E-102 |
| sp|Q31BU4|PROA_PROM9 | Gamma-glutamyl phosphate reductase OS=Prochlorococcus marinus (strain MIT 9312) GN=proA PE=3 SV=1 | 10 | 423 | 6.0E-102 |
| sp|Q18J39|PROA_HALWD | Gamma-glutamyl phosphate reductase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=proA PE=3 SV=2 | 7 | 420 | 2.0E-101 |
| sp|Q7V293|PROA_PROMP | Gamma-glutamyl phosphate reductase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=proA PE=3 SV=1 | 10 | 421 | 3.0E-100 |
| sp|A8G3V6|PROA_PROM2 | Gamma-glutamyl phosphate reductase OS=Prochlorococcus marinus (strain MIT 9215) GN=proA PE=3 SV=1 | 10 | 423 | 2.0E-99 |
| sp|A2BVQ3|PROA_PROM5 | Gamma-glutamyl phosphate reductase OS=Prochlorococcus marinus (strain MIT 9515) GN=proA PE=3 SV=1 | 12 | 423 | 1.0E-98 |
| sp|O65361|P5CS_MESCR | Delta-1-pyrroline-5-carboxylate synthase OS=Mesembryanthemum crystallinum GN=P5CS PE=2 SV=1 | 10 | 425 | 6.0E-98 |
| sp|Q96480|P5CS_SOLLC | Delta-1-pyrroline-5-carboxylate synthase OS=Solanum lycopersicum GN=PRO2 PE=2 SV=1 | 2 | 406 | 1.0E-96 |
| sp|P54887|P5CS1_ARATH | Delta-1-pyrroline-5-carboxylate synthase A OS=Arabidopsis thaliana GN=P5CSA PE=1 SV=1 | 3 | 425 | 4.0E-96 |
| sp|O04015|P5CS_ACTDE | Delta-1-pyrroline-5-carboxylate synthase OS=Actinidia deliciosa PE=2 SV=1 | 8 | 406 | 2.0E-95 |
| sp|O04226|P5CS_ORYSJ | Delta-1-pyrroline-5-carboxylate synthase OS=Oryza sativa subsp. japonica GN=P5CS PE=2 SV=2 | 7 | 425 | 5.0E-95 |
| sp|P54888|P5CS2_ARATH | Delta-1-pyrroline-5-carboxylate synthase B OS=Arabidopsis thaliana GN=P5CSB PE=2 SV=1 | 3 | 425 | 1.0E-94 |
| sp|A2BQ71|PROA_PROMS | Gamma-glutamyl phosphate reductase OS=Prochlorococcus marinus (strain AS9601) GN=proA PE=3 SV=1 | 10 | 423 | 5.0E-94 |
| sp|Q2SA27|PROA_HAHCH | Gamma-glutamyl phosphate reductase OS=Hahella chejuensis (strain KCTC 2396) GN=proA PE=3 SV=1 | 5 | 404 | 7.0E-94 |
| sp|B9L9A2|PROA_NAUPA | Gamma-glutamyl phosphate reductase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=proA PE=3 SV=1 | 9 | 406 | 5.0E-93 |
| sp|Q83SH9|PROA_SHIFL | Gamma-glutamyl phosphate reductase OS=Shigella flexneri GN=proA PE=3 SV=1 | 9 | 405 | 3.0E-91 |
| sp|Q0T7R6|PROA_SHIF8 | Gamma-glutamyl phosphate reductase OS=Shigella flexneri serotype 5b (strain 8401) GN=proA PE=3 SV=1 | 9 | 405 | 3.0E-91 |
| sp|Q7NQ51|PROA_CHRVO | Gamma-glutamyl phosphate reductase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=proA PE=3 SV=1 | 9 | 406 | 4.0E-91 |
| sp|B7LNF7|PROA_ESCF3 | Gamma-glutamyl phosphate reductase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=proA PE=3 SV=1 | 9 | 405 | 1.0E-90 |
| sp|C5CE09|PROA_KOSOT | Gamma-glutamyl phosphate reductase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=proA PE=3 SV=1 | 12 | 406 | 1.0E-90 |
| sp|B7N8H4|PROA_ECOLU | Gamma-glutamyl phosphate reductase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=proA PE=3 SV=1 | 9 | 405 | 1.0E-90 |
| sp|A8AKP4|PROA_CITK8 | Gamma-glutamyl phosphate reductase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=proA PE=3 SV=1 | 9 | 404 | 1.0E-90 |
| sp|B0VKT1|PROA_ACIBS | Gamma-glutamyl phosphate reductase OS=Acinetobacter baumannii (strain SDF) GN=proA PE=3 SV=1 | 9 | 406 | 1.0E-90 |
| sp|B2I3D3|PROA_ACIBC | Gamma-glutamyl phosphate reductase OS=Acinetobacter baumannii (strain ACICU) GN=proA PE=3 SV=1 | 9 | 406 | 1.0E-90 |
| sp|B5Z1I7|PROA_ECO5E | Gamma-glutamyl phosphate reductase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=proA PE=3 SV=1 | 9 | 405 | 1.0E-90 |
| sp|Q8X7N4|PROA_ECO57 | Gamma-glutamyl phosphate reductase OS=Escherichia coli O157:H7 GN=proA PE=3 SV=1 | 9 | 405 | 1.0E-90 |
| sp|P54889|ALH13_CAEEL | Probable delta-1-pyrroline-5-carboxylate synthase OS=Caenorhabditis elegans GN=alh-13 PE=3 SV=2 | 9 | 423 | 4.0E-90 |
| sp|A5WH78|PROA_PSYWF | Gamma-glutamyl phosphate reductase OS=Psychrobacter sp. (strain PRwf-1) GN=proA PE=3 SV=1 | 9 | 403 | 4.0E-90 |
| sp|B0V4S6|PROA_ACIBY | Gamma-glutamyl phosphate reductase OS=Acinetobacter baumannii (strain AYE) GN=proA PE=3 SV=1 | 9 | 406 | 6.0E-90 |
| sp|B7I5F5|PROA_ACIB5 | Gamma-glutamyl phosphate reductase OS=Acinetobacter baumannii (strain AB0057) GN=proA PE=3 SV=1 | 9 | 406 | 6.0E-90 |
| sp|B7H081|PROA_ACIB3 | Gamma-glutamyl phosphate reductase OS=Acinetobacter baumannii (strain AB307-0294) GN=proA PE=3 SV=1 | 9 | 406 | 6.0E-90 |
| sp|Q6FEN5|PROA_ACIAD | Gamma-glutamyl phosphate reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=proA PE=3 SV=1 | 11 | 406 | 7.0E-90 |
| sp|B7UJD1|PROA_ECO27 | Gamma-glutamyl phosphate reductase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=proA PE=3 SV=1 | 9 | 405 | 7.0E-90 |
| sp|Q9Z110|P5CS_MOUSE | Delta-1-pyrroline-5-carboxylate synthase OS=Mus musculus GN=Aldh18a1 PE=1 SV=2 | 7 | 425 | 9.0E-90 |
| sp|A6VZ85|PROA_MARMS | Gamma-glutamyl phosphate reductase OS=Marinomonas sp. (strain MWYL1) GN=proA PE=3 SV=1 | 10 | 404 | 1.0E-89 |
| sp|A6T561|PROA_KLEP7 | Gamma-glutamyl phosphate reductase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=proA PE=3 SV=1 | 9 | 404 | 1.0E-89 |
| sp|A3M1Z8|PROA_ACIBT | Gamma-glutamyl phosphate reductase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=proA PE=3 SV=2 | 9 | 406 | 2.0E-89 |
| sp|B5Y169|PROA_KLEP3 | Gamma-glutamyl phosphate reductase OS=Klebsiella pneumoniae (strain 342) GN=proA PE=3 SV=1 | 9 | 404 | 2.0E-89 |
| sp|Q0TL73|PROA_ECOL5 | Gamma-glutamyl phosphate reductase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=proA PE=3 SV=1 | 9 | 405 | 2.0E-89 |
| sp|B7NK82|PROA_ECO7I | Gamma-glutamyl phosphate reductase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=proA PE=3 SV=1 | 9 | 405 | 2.0E-89 |
| sp|B7MQ79|PROA_ECO81 | Gamma-glutamyl phosphate reductase OS=Escherichia coli O81 (strain ED1a) GN=proA PE=3 SV=1 | 9 | 405 | 2.0E-89 |
| sp|A4W6X5|PROA_ENT38 | Gamma-glutamyl phosphate reductase OS=Enterobacter sp. (strain 638) GN=proA PE=3 SV=1 | 9 | 404 | 3.0E-89 |
| sp|Q1RFS7|PROA_ECOUT | Gamma-glutamyl phosphate reductase OS=Escherichia coli (strain UTI89 / UPEC) GN=proA PE=3 SV=1 | 9 | 405 | 4.0E-89 |
| sp|A1A7V4|PROA_ECOK1 | Gamma-glutamyl phosphate reductase OS=Escherichia coli O1:K1 / APEC GN=proA PE=3 SV=1 | 9 | 405 | 4.0E-89 |
| sp|B7MC93|PROA_ECO45 | Gamma-glutamyl phosphate reductase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=proA PE=3 SV=1 | 9 | 405 | 4.0E-89 |
| sp|Q5R4M8|P5CS_PONAB | Delta-1-pyrroline-5-carboxylate synthase OS=Pongo abelii GN=ALDH18A1 PE=2 SV=1 | 7 | 425 | 6.0E-89 |
| sp|B1LHT9|PROA_ECOSM | Gamma-glutamyl phosphate reductase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=proA PE=3 SV=1 | 9 | 405 | 9.0E-89 |
| sp|Q8FKM3|PROA_ECOL6 | Gamma-glutamyl phosphate reductase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=proA PE=3 SV=1 | 9 | 405 | 1.0E-88 |
| sp|Q325P3|PROA_SHIBS | Gamma-glutamyl phosphate reductase OS=Shigella boydii serotype 4 (strain Sb227) GN=proA PE=3 SV=1 | 9 | 405 | 1.0E-88 |
| sp|B2U3T4|PROA_SHIB3 | Gamma-glutamyl phosphate reductase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=proA PE=3 SV=1 | 9 | 405 | 1.0E-88 |
| sp|Q2YBP9|PROA_NITMU | Gamma-glutamyl phosphate reductase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=proA PE=3 SV=1 | 11 | 404 | 1.0E-88 |
| sp|Q1QXB4|PROA_CHRSD | Gamma-glutamyl phosphate reductase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=proA PE=3 SV=1 | 15 | 404 | 1.0E-88 |
| sp|B6I023|PROA_ECOSE | Gamma-glutamyl phosphate reductase OS=Escherichia coli (strain SE11) GN=proA PE=3 SV=1 | 9 | 405 | 2.0E-88 |
| sp|A7ZWK6|PROA_ECOHS | Gamma-glutamyl phosphate reductase OS=Escherichia coli O9:H4 (strain HS) GN=proA PE=3 SV=1 | 9 | 405 | 2.0E-88 |
| sp|B7M272|PROA_ECO8A | Gamma-glutamyl phosphate reductase OS=Escherichia coli O8 (strain IAI1) GN=proA PE=3 SV=1 | 9 | 405 | 2.0E-88 |
| sp|A7ZI02|PROA_ECO24 | Gamma-glutamyl phosphate reductase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=proA PE=3 SV=1 | 9 | 405 | 2.0E-88 |
| sp|Q1QDZ7|PROA_PSYCK | Gamma-glutamyl phosphate reductase OS=Psychrobacter cryohalolentis (strain K5) GN=proA PE=3 SV=1 | 26 | 417 | 2.0E-88 |
| sp|B7L3Z5|PROA_ECO55 | Gamma-glutamyl phosphate reductase OS=Escherichia coli (strain 55989 / EAEC) GN=proA PE=3 SV=1 | 9 | 405 | 2.0E-88 |
| sp|B4TZ91|PROA_SALSV | Gamma-glutamyl phosphate reductase OS=Salmonella schwarzengrund (strain CVM19633) GN=proA PE=3 SV=1 | 9 | 404 | 2.0E-88 |
| sp|Q3Z594|PROA_SHISS | Gamma-glutamyl phosphate reductase OS=Shigella sonnei (strain Ss046) GN=proA PE=3 SV=1 | 9 | 405 | 3.0E-88 |
| sp|P07004|PROA_ECOLI | Gamma-glutamyl phosphate reductase OS=Escherichia coli (strain K12) GN=proA PE=1 SV=2 | 9 | 405 | 3.0E-88 |
| sp|B1J0Z1|PROA_ECOLC | Gamma-glutamyl phosphate reductase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=proA PE=3 SV=1 | 9 | 405 | 3.0E-88 |
| sp|B1XDY6|PROA_ECODH | Gamma-glutamyl phosphate reductase OS=Escherichia coli (strain K12 / DH10B) GN=proA PE=3 SV=1 | 9 | 405 | 3.0E-88 |
| sp|C4ZTA0|PROA_ECOBW | Gamma-glutamyl phosphate reductase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=proA PE=3 SV=1 | 9 | 405 | 3.0E-88 |
| sp|P54886|P5CS_HUMAN | Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens GN=ALDH18A1 PE=1 SV=2 | 7 | 425 | 6.0E-88 |
| sp|Q32J27|PROA_SHIDS | Gamma-glutamyl phosphate reductase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=proA PE=3 SV=1 | 9 | 405 | 9.0E-88 |
| sp|A1JNX6|PROA_YERE8 | Gamma-glutamyl phosphate reductase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=proA PE=3 SV=1 | 9 | 404 | 1.0E-87 |
| sp|C0Q6U2|PROA_SALPC | Gamma-glutamyl phosphate reductase OS=Salmonella paratyphi C (strain RKS4594) GN=proA PE=3 SV=1 | 9 | 404 | 1.0E-87 |
| sp|Q57ST2|PROA_SALCH | Gamma-glutamyl phosphate reductase OS=Salmonella choleraesuis (strain SC-B67) GN=proA PE=3 SV=1 | 9 | 404 | 1.0E-87 |
| sp|B5BDP7|PROA_SALPK | Gamma-glutamyl phosphate reductase OS=Salmonella paratyphi A (strain AKU_12601) GN=proA PE=3 SV=1 | 9 | 404 | 2.0E-87 |
| sp|Q5PF69|PROA_SALPA | Gamma-glutamyl phosphate reductase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=proA PE=3 SV=1 | 9 | 404 | 2.0E-87 |
| sp|B4T7Q6|PROA_SALHS | Gamma-glutamyl phosphate reductase OS=Salmonella heidelberg (strain SL476) GN=proA PE=3 SV=1 | 9 | 404 | 2.0E-87 |
| sp|Q3J7T1|PROA_NITOC | Gamma-glutamyl phosphate reductase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=proA PE=3 SV=1 | 9 | 404 | 2.0E-87 |
| sp|P40861|PROA_SALTY | Gamma-glutamyl phosphate reductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proA PE=3 SV=2 | 9 | 404 | 3.0E-87 |
| sp|A1WYZ4|PROA_HALHL | Gamma-glutamyl phosphate reductase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=proA PE=3 SV=1 | 30 | 404 | 5.0E-87 |
| sp|A9MY02|PROA_SALPB | Gamma-glutamyl phosphate reductase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=proA PE=3 SV=1 | 9 | 404 | 6.0E-87 |
| sp|Q21FC9|PROA_SACD2 | Gamma-glutamyl phosphate reductase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=proA PE=3 SV=2 | 15 | 404 | 7.0E-87 |
| sp|Q8Z932|PROA_SALTI | Gamma-glutamyl phosphate reductase OS=Salmonella typhi GN=proA PE=3 SV=1 | 9 | 404 | 7.0E-87 |
| sp|B5EWK6|PROA_SALA4 | Gamma-glutamyl phosphate reductase OS=Salmonella agona (strain SL483) GN=proA PE=3 SV=1 | 9 | 404 | 8.0E-87 |
| sp|B1JIH2|PROA_YERPY | Gamma-glutamyl phosphate reductase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=proA PE=3 SV=1 | 9 | 404 | 9.0E-87 |
| sp|Q66DY8|PROA_YERPS | Gamma-glutamyl phosphate reductase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=proA PE=3 SV=1 | 9 | 404 | 9.0E-87 |
| sp|B2K6Q4|PROA_YERPB | Gamma-glutamyl phosphate reductase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=proA PE=3 SV=1 | 9 | 404 | 9.0E-87 |
| sp|A7FLI1|PROA_YERP3 | Gamma-glutamyl phosphate reductase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=proA PE=3 SV=1 | 9 | 404 | 9.0E-87 |
| sp|B5R5R9|PROA_SALG2 | Gamma-glutamyl phosphate reductase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=proA PE=3 SV=1 | 9 | 404 | 1.0E-86 |
| sp|B5R4S6|PROA_SALEP | Gamma-glutamyl phosphate reductase OS=Salmonella enteritidis PT4 (strain P125109) GN=proA PE=3 SV=1 | 9 | 404 | 1.0E-86 |
| sp|B5FJX5|PROA_SALDC | Gamma-glutamyl phosphate reductase OS=Salmonella dublin (strain CT_02021853) GN=proA PE=3 SV=1 | 9 | 404 | 1.0E-86 |
| sp|Q6D1I4|PROA_PECAS | Gamma-glutamyl phosphate reductase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=proA PE=3 SV=1 | 9 | 404 | 1.0E-86 |
| sp|Q4FUZ5|PROA_PSYA2 | Gamma-glutamyl phosphate reductase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=proA PE=3 SV=2 | 26 | 417 | 1.0E-86 |
| sp|B4SVW6|PROA_SALNS | Gamma-glutamyl phosphate reductase OS=Salmonella newport (strain SL254) GN=proA PE=3 SV=1 | 9 | 404 | 1.0E-86 |
| sp|A9HWX2|PROA_BORPD | Gamma-glutamyl phosphate reductase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=proA PE=3 SV=1 | 15 | 406 | 2.0E-86 |
| sp|A4TPK0|PROA_YERPP | Gamma-glutamyl phosphate reductase OS=Yersinia pestis (strain Pestoides F) GN=proA PE=3 SV=1 | 9 | 404 | 2.0E-86 |
| sp|Q1CLC6|PROA_YERPN | Gamma-glutamyl phosphate reductase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=proA PE=3 SV=1 | 9 | 404 | 2.0E-86 |
| sp|A9R2X0|PROA_YERPG | Gamma-glutamyl phosphate reductase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=proA PE=3 SV=1 | 9 | 404 | 2.0E-86 |
| sp|Q8ZC09|PROA_YERPE | Gamma-glutamyl phosphate reductase OS=Yersinia pestis GN=proA PE=3 SV=1 | 9 | 404 | 2.0E-86 |
| sp|Q1C4E7|PROA_YERPA | Gamma-glutamyl phosphate reductase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=proA PE=3 SV=1 | 9 | 404 | 2.0E-86 |
| sp|C4Z075|PROA_EUBE2 | Gamma-glutamyl phosphate reductase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=proA PE=3 SV=1 | 7 | 406 | 3.0E-86 |
| sp|A6Q3B4|PROA_NITSB | Gamma-glutamyl phosphate reductase OS=Nitratiruptor sp. (strain SB155-2) GN=proA PE=3 SV=1 | 9 | 406 | 1.0E-85 |
| sp|A4XYY4|PROA_PSEMY | Gamma-glutamyl phosphate reductase OS=Pseudomonas mendocina (strain ymp) GN=proA PE=3 SV=1 | 11 | 404 | 1.0E-85 |
| sp|B2JGX3|PROA_BURP8 | Gamma-glutamyl phosphate reductase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=proA PE=3 SV=1 | 15 | 403 | 2.0E-85 |
| sp|Q39JM2|PROA_BURL3 | Gamma-glutamyl phosphate reductase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=proA PE=3 SV=2 | 15 | 403 | 2.0E-85 |
| sp|Q46XE1|PROA_CUPPJ | Gamma-glutamyl phosphate reductase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=proA PE=3 SV=1 | 26 | 403 | 3.0E-85 |
| sp|Q0ABN0|PROA_ALKEH | Gamma-glutamyl phosphate reductase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=proA PE=3 SV=1 | 15 | 404 | 4.0E-85 |
| sp|A6QB48|PROA_SULNB | Gamma-glutamyl phosphate reductase OS=Sulfurovum sp. (strain NBC37-1) GN=proA PE=3 SV=1 | 15 | 417 | 5.0E-85 |
| sp|B2VHM6|PROA_ERWT9 | Gamma-glutamyl phosphate reductase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=proA PE=3 SV=1 | 9 | 404 | 5.0E-85 |
| sp|Q87VV6|PROA_PSESM | Gamma-glutamyl phosphate reductase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=proA PE=3 SV=1 | 14 | 406 | 1.0E-84 |
| sp|Q0BIB2|PROA_BURCM | Gamma-glutamyl phosphate reductase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=proA PE=3 SV=1 | 15 | 403 | 1.0E-84 |
| sp|B1YTB0|PROA_BURA4 | Gamma-glutamyl phosphate reductase OS=Burkholderia ambifaria (strain MC40-6) GN=proA PE=3 SV=1 | 15 | 403 | 1.0E-84 |
| sp|Q48DL4|PROA_PSE14 | Gamma-glutamyl phosphate reductase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=proA PE=3 SV=1 | 14 | 406 | 1.0E-84 |
| sp|O67166|PROA_AQUAE | Gamma-glutamyl phosphate reductase OS=Aquifex aeolicus (strain VF5) GN=proA PE=3 SV=2 | 9 | 421 | 1.0E-84 |
| sp|B0TBV8|PROA_HELMI | Gamma-glutamyl phosphate reductase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=proA PE=3 SV=1 | 15 | 406 | 2.0E-84 |
| sp|Q62H23|PROA_BURMA | Gamma-glutamyl phosphate reductase OS=Burkholderia mallei (strain ATCC 23344) GN=proA PE=3 SV=1 | 10 | 403 | 2.0E-84 |
| sp|A9MNR4|PROA_SALAR | Gamma-glutamyl phosphate reductase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=proA PE=3 SV=1 | 9 | 404 | 2.0E-84 |
| sp|B3R6R0|PROA_CUPTR | Gamma-glutamyl phosphate reductase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=proA PE=3 SV=1 | 26 | 403 | 2.0E-84 |
| sp|Q9CM98|PROA_PASMU | Gamma-glutamyl phosphate reductase OS=Pasteurella multocida (strain Pm70) GN=proA PE=3 SV=1 | 9 | 405 | 3.0E-84 |
| sp|Q4K5F9|PROA_PSEF5 | Gamma-glutamyl phosphate reductase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=proA PE=3 SV=2 | 11 | 404 | 4.0E-84 |
| sp|A8GAD4|PROA_SERP5 | Gamma-glutamyl phosphate reductase OS=Serratia proteamaculans (strain 568) GN=proA PE=3 SV=1 | 9 | 404 | 4.0E-84 |
| sp|Q0BWP1|PROA_HYPNA | Gamma-glutamyl phosphate reductase OS=Hyphomonas neptunium (strain ATCC 15444) GN=proA PE=3 SV=1 | 15 | 406 | 5.0E-84 |
| sp|Q5P255|PROA_AROAE | Gamma-glutamyl phosphate reductase OS=Aromatoleum aromaticum (strain EbN1) GN=proA PE=3 SV=1 | 15 | 404 | 6.0E-84 |
| sp|A8EVN0|PROA_ARCB4 | Gamma-glutamyl phosphate reductase OS=Arcobacter butzleri (strain RM4018) GN=proA PE=3 SV=1 | 9 | 406 | 8.0E-84 |
| sp|A6VMV2|PROA_ACTSZ | Gamma-glutamyl phosphate reductase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=proA PE=3 SV=1 | 9 | 405 | 9.0E-84 |
| sp|Q65S49|PROA_MANSM | Gamma-glutamyl phosphate reductase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=proA PE=3 SV=1 | 10 | 405 | 1.0E-83 |
| sp|C5BNN0|PROA_TERTT | Gamma-glutamyl phosphate reductase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=proA PE=3 SV=1 | 9 | 404 | 1.0E-83 |
| sp|A6LPD5|PROA_CLOB8 | Gamma-glutamyl phosphate reductase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=proA PE=3 SV=1 | 15 | 406 | 1.0E-83 |
| sp|Q8RAE5|PROA_CALS4 | Gamma-glutamyl phosphate reductase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=proA PE=3 SV=1 | 12 | 406 | 1.0E-83 |
| sp|Q2LU85|PROA_SYNAS | Gamma-glutamyl phosphate reductase OS=Syntrophus aciditrophicus (strain SB) GN=proA PE=3 SV=1 | 10 | 406 | 2.0E-83 |
| sp|Q4ZN73|PROA_PSEU2 | Gamma-glutamyl phosphate reductase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=proA PE=3 SV=1 | 14 | 406 | 2.0E-83 |
| sp|Q0K710|PROA_CUPNH | Gamma-glutamyl phosphate reductase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=proA PE=3 SV=1 | 26 | 403 | 3.0E-83 |
| sp|B2IE42|PROA_BEII9 | Gamma-glutamyl phosphate reductase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=proA PE=3 SV=1 | 15 | 406 | 4.0E-83 |
| sp|B1M695|PROA_METRJ | Gamma-glutamyl phosphate reductase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=proA PE=3 SV=1 | 30 | 406 | 4.0E-83 |
| sp|Q63QT9|PROA_BURPS | Gamma-glutamyl phosphate reductase OS=Burkholderia pseudomallei (strain K96243) GN=proA PE=3 SV=2 | 10 | 403 | 4.0E-83 |
| sp|Q3JNN5|PROA_BURP1 | Gamma-glutamyl phosphate reductase OS=Burkholderia pseudomallei (strain 1710b) GN=proA PE=3 SV=1 | 10 | 403 | 4.0E-83 |
| sp|A7MI49|PROA_CROS8 | Gamma-glutamyl phosphate reductase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=proA PE=3 SV=1 | 9 | 404 | 5.0E-83 |
| sp|Q7VI05|PROA_HELHP | Gamma-glutamyl phosphate reductase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=proA PE=3 SV=1 | 15 | 406 | 5.0E-83 |
| sp|B1JVH2|PROA_BURCC | Gamma-glutamyl phosphate reductase OS=Burkholderia cenocepacia (strain MC0-3) GN=proA PE=3 SV=1 | 15 | 403 | 6.0E-83 |
| sp|Q1LJ33|PROA_CUPMC | Gamma-glutamyl phosphate reductase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=proA PE=3 SV=1 | 28 | 403 | 6.0E-83 |
| sp|Q606Y1|PROA_METCA | Gamma-glutamyl phosphate reductase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=proA PE=3 SV=1 | 80 | 404 | 7.0E-83 |
| sp|Q2RKZ6|PROA_MOOTA | Gamma-glutamyl phosphate reductase OS=Moorella thermoacetica (strain ATCC 39073) GN=proA PE=3 SV=1 | 15 | 406 | 7.0E-83 |
| sp|Q0VN49|PROA_ALCBS | Gamma-glutamyl phosphate reductase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=proA PE=3 SV=1 | 9 | 404 | 9.0E-83 |
| sp|A1U3C3|PROA_MARHV | Gamma-glutamyl phosphate reductase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=proA PE=3 SV=1 | 10 | 404 | 9.0E-83 |
| sp|Q2RV06|PROA_RHORT | Gamma-glutamyl phosphate reductase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=proA PE=3 SV=1 | 52 | 406 | 1.0E-82 |
| sp|A4VR07|PROA_PSEU5 | Gamma-glutamyl phosphate reductase OS=Pseudomonas stutzeri (strain A1501) GN=proA PE=3 SV=1 | 11 | 404 | 1.0E-82 |
| sp|B8CKF0|PROA_SHEPW | Gamma-glutamyl phosphate reductase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=proA PE=3 SV=1 | 4 | 405 | 1.0E-82 |
| sp|A5N0V1|PROA_CLOK5 | Gamma-glutamyl phosphate reductase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=proA PE=3 SV=1 | 10 | 406 | 1.0E-82 |
| sp|B9E4Q5|PROA_CLOK1 | Gamma-glutamyl phosphate reductase OS=Clostridium kluyveri (strain NBRC 12016) GN=proA PE=3 SV=1 | 10 | 406 | 1.0E-82 |
| sp|C6DCX4|PROA_PECCP | Gamma-glutamyl phosphate reductase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=proA PE=3 SV=1 | 9 | 404 | 1.0E-82 |
| sp|C1D6E4|PROA_LARHH | Gamma-glutamyl phosphate reductase OS=Laribacter hongkongensis (strain HLHK9) GN=proA PE=3 SV=1 | 9 | 406 | 2.0E-82 |
| sp|Q47IN4|PROA_DECAR | Gamma-glutamyl phosphate reductase OS=Dechloromonas aromatica (strain RCB) GN=proA PE=3 SV=1 | 15 | 404 | 2.0E-82 |
| sp|Q2NVE9|PROA_SODGM | Gamma-glutamyl phosphate reductase OS=Sodalis glossinidius (strain morsitans) GN=proA PE=3 SV=1 | 9 | 404 | 2.0E-82 |
| sp|Q3SVI0|PROA_NITWN | Gamma-glutamyl phosphate reductase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=proA PE=3 SV=2 | 10 | 406 | 2.0E-82 |
| sp|Q30SG0|PROA_SULDN | Gamma-glutamyl phosphate reductase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=proA PE=3 SV=1 | 9 | 417 | 3.0E-82 |
| sp|A6T242|PROA_JANMA | Gamma-glutamyl phosphate reductase OS=Janthinobacterium sp. (strain Marseille) GN=proA PE=3 SV=2 | 9 | 403 | 3.0E-82 |
| sp|A9W6Q2|PROA_METEP | Gamma-glutamyl phosphate reductase OS=Methylobacterium extorquens (strain PA1) GN=proA PE=3 SV=1 | 30 | 406 | 3.0E-82 |
| sp|A0KNQ8|PROA_AERHH | Gamma-glutamyl phosphate reductase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=proA PE=3 SV=1 | 7 | 405 | 3.0E-82 |
| sp|Q28Q10|PROA_JANSC | Gamma-glutamyl phosphate reductase OS=Jannaschia sp. (strain CCS1) GN=proA PE=3 SV=1 | 10 | 404 | 4.0E-82 |
| sp|A0K4I3|PROA_BURCH | Gamma-glutamyl phosphate reductase OS=Burkholderia cenocepacia (strain HI2424) GN=proA PE=3 SV=2 | 15 | 403 | 4.0E-82 |
| sp|Q1BZ67|PROA_BURCA | Gamma-glutamyl phosphate reductase OS=Burkholderia cenocepacia (strain AU 1054) GN=proA PE=3 SV=2 | 15 | 403 | 4.0E-82 |
| sp|Q0TM73|PROA_CLOP1 | Gamma-glutamyl phosphate reductase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=proA PE=3 SV=1 | 15 | 406 | 7.0E-82 |
| sp|A4JBI4|PROA_BURVG | Gamma-glutamyl phosphate reductase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=proA PE=3 SV=1 | 15 | 403 | 8.0E-82 |
| sp|Q8XHA7|PROA_CLOPE | Gamma-glutamyl phosphate reductase OS=Clostridium perfringens (strain 13 / Type A) GN=proA PE=3 SV=1 | 15 | 406 | 1.0E-81 |
| sp|Q220P2|PROA_RHOFT | Gamma-glutamyl phosphate reductase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=proA PE=3 SV=1 | 4 | 404 | 1.0E-81 |
| sp|Q6LTX2|PROA_PHOPR | Gamma-glutamyl phosphate reductase OS=Photobacterium profundum GN=proA PE=3 SV=1 | 9 | 405 | 1.0E-81 |
| sp|B4U8A0|PROA_HYDS0 | Gamma-glutamyl phosphate reductase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=proA PE=3 SV=1 | 10 | 412 | 1.0E-81 |
| sp|Q31IE5|PROA_THICR | Gamma-glutamyl phosphate reductase OS=Thiomicrospira crunogena (strain XCL-2) GN=proA PE=3 SV=2 | 9 | 404 | 2.0E-81 |
| sp|C3K2M9|PROA_PSEFS | Gamma-glutamyl phosphate reductase OS=Pseudomonas fluorescens (strain SBW25) GN=proA PE=3 SV=1 | 14 | 404 | 2.0E-81 |
| sp|B7KS47|PROA_METC4 | Gamma-glutamyl phosphate reductase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=proA PE=3 SV=1 | 30 | 406 | 2.0E-81 |
| sp|Q747Q4|PROA_GEOSL | Gamma-glutamyl phosphate reductase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=proA PE=3 SV=1 | 22 | 406 | 2.0E-81 |
| sp|Q7M8Z4|PROA_WOLSU | Gamma-glutamyl phosphate reductase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=proA PE=3 SV=1 | 15 | 406 | 2.0E-81 |
| sp|Q3AF39|PROA_CARHZ | Gamma-glutamyl phosphate reductase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=proA PE=3 SV=1 | 25 | 406 | 3.0E-81 |
| sp|B0KJY5|PROA_PSEPG | Gamma-glutamyl phosphate reductase OS=Pseudomonas putida (strain GB-1) GN=proA PE=3 SV=1 | 11 | 406 | 3.0E-81 |
| sp|A4SJF6|PROA_AERS4 | Gamma-glutamyl phosphate reductase OS=Aeromonas salmonicida (strain A449) GN=proA PE=3 SV=1 | 7 | 405 | 3.0E-81 |
| sp|B8G8E0|PROA_CHLAD | Gamma-glutamyl phosphate reductase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=proA PE=3 SV=1 | 9 | 405 | 3.0E-81 |
| sp|Q0SPX8|PROA_CLOPS | Gamma-glutamyl phosphate reductase OS=Clostridium perfringens (strain SM101 / Type A) GN=proA PE=3 SV=1 | 15 | 406 | 3.0E-81 |
| sp|B3E3M7|PROA_GEOLS | Gamma-glutamyl phosphate reductase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=proA PE=3 SV=1 | 11 | 406 | 3.0E-81 |
| sp|Q9HX20|PROA_PSEAE | Gamma-glutamyl phosphate reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=proA PE=3 SV=1 | 51 | 404 | 4.0E-81 |
| sp|B7V8A7|PROA_PSEA8 | Gamma-glutamyl phosphate reductase OS=Pseudomonas aeruginosa (strain LESB58) GN=proA PE=3 SV=1 | 51 | 404 | 4.0E-81 |
| sp|A8AX77|PROA_STRGC | Gamma-glutamyl phosphate reductase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=proA PE=3 SV=1 | 7 | 406 | 4.0E-81 |
| sp|Q6NDE4|PROA_RHOPA | Gamma-glutamyl phosphate reductase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=proA PE=3 SV=1 | 30 | 406 | 5.0E-81 |
| sp|Q0I2E5|PROA_HAES1 | Gamma-glutamyl phosphate reductase OS=Haemophilus somnus (strain 129Pt) GN=proA PE=3 SV=1 | 9 | 405 | 5.0E-81 |
| sp|B1ZFJ0|PROA_METPB | Gamma-glutamyl phosphate reductase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=proA PE=3 SV=1 | 30 | 406 | 6.0E-81 |
| sp|B0USH2|PROA_HISS2 | Gamma-glutamyl phosphate reductase OS=Histophilus somni (strain 2336) GN=proA PE=3 SV=1 | 7 | 405 | 7.0E-81 |
| sp|B3Q733|PROA_RHOPT | Gamma-glutamyl phosphate reductase OS=Rhodopseudomonas palustris (strain TIE-1) GN=proA PE=3 SV=1 | 30 | 406 | 7.0E-81 |
| sp|B2V9F3|PROA_SULSY | Gamma-glutamyl phosphate reductase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=proA PE=3 SV=1 | 8 | 406 | 7.0E-81 |
| sp|A3CMT1|PROA_STRSV | Gamma-glutamyl phosphate reductase OS=Streptococcus sanguinis (strain SK36) GN=proA PE=3 SV=1 | 7 | 406 | 8.0E-81 |
| sp|Q896G4|PROA_CLOTE | Gamma-glutamyl phosphate reductase OS=Clostridium tetani (strain Massachusetts / E88) GN=proA PE=3 SV=1 | 15 | 406 | 8.0E-81 |
| sp|A1AUT0|PROA_PELPD | Gamma-glutamyl phosphate reductase OS=Pelobacter propionicus (strain DSM 2379) GN=proA PE=3 SV=1 | 10 | 406 | 9.0E-81 |
| sp|B4EUV1|PROA_PROMH | Gamma-glutamyl phosphate reductase OS=Proteus mirabilis (strain HI4320) GN=proA PE=3 SV=1 | 9 | 404 | 9.0E-81 |
| sp|Q2SZ88|PROA_BURTA | Gamma-glutamyl phosphate reductase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=proA PE=1 SV=1 | 28 | 403 | 9.0E-81 |
| sp|B6JD19|PROA_OLICO | Gamma-glutamyl phosphate reductase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=proA PE=3 SV=1 | 48 | 406 | 1.0E-80 |
| sp|Q88DL4|PROA_PSEPK | Gamma-glutamyl phosphate reductase OS=Pseudomonas putida (strain KT2440) GN=proA PE=3 SV=1 | 11 | 406 | 1.0E-80 |
| sp|P17857|PROA_SERMA | Gamma-glutamyl phosphate reductase OS=Serratia marcescens GN=proA PE=3 SV=1 | 9 | 404 | 1.0E-80 |
| sp|Q7N7B1|PROA_PHOLL | Gamma-glutamyl phosphate reductase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=proA PE=3 SV=1 | 9 | 399 | 1.0E-80 |
| sp|Q3SG61|PROA_THIDA | Gamma-glutamyl phosphate reductase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=proA PE=3 SV=2 | 15 | 404 | 1.0E-80 |
| sp|A4G8E9|PROA_HERAR | Gamma-glutamyl phosphate reductase OS=Herminiimonas arsenicoxydans GN=proA PE=3 SV=1 | 9 | 403 | 1.0E-80 |
| sp|Q87RU9|PROA_VIBPA | Gamma-glutamyl phosphate reductase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=proA PE=3 SV=1 | 1 | 405 | 2.0E-80 |
| sp|A6V0A3|PROA_PSEA7 | Gamma-glutamyl phosphate reductase OS=Pseudomonas aeruginosa (strain PA7) GN=proA PE=3 SV=1 | 51 | 404 | 2.0E-80 |
| sp|Q820I7|PROA_NITEU | Gamma-glutamyl phosphate reductase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=proA PE=3 SV=1 | 61 | 404 | 2.0E-80 |
| sp|B2THG5|PROA_CLOBB | Gamma-glutamyl phosphate reductase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=proA PE=3 SV=1 | 15 | 406 | 2.0E-80 |
| sp|Q2VZT9|PROA_MAGSA | Gamma-glutamyl phosphate reductase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=proA PE=3 SV=1 | 15 | 406 | 2.0E-80 |
| sp|Q02SH4|PROA_PSEAB | Gamma-glutamyl phosphate reductase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=proA PE=3 SV=1 | 51 | 404 | 2.0E-80 |
| sp|B1ZMC1|PROA_OPITP | Gamma-glutamyl phosphate reductase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=proA PE=3 SV=1 | 11 | 403 | 3.0E-80 |
| sp|A1KAH8|PROA_AZOSB | Gamma-glutamyl phosphate reductase OS=Azoarcus sp. (strain BH72) GN=proA PE=3 SV=1 | 15 | 404 | 3.0E-80 |
| sp|A0LCZ1|PROA_MAGMM | Gamma-glutamyl phosphate reductase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=proA PE=3 SV=1 | 9 | 406 | 4.0E-80 |
| sp|A4SVE2|PROA_POLSQ | Gamma-glutamyl phosphate reductase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=proA PE=3 SV=2 | 9 | 403 | 4.0E-80 |
| sp|Q1WRR6|PROA_LACS1 | Gamma-glutamyl phosphate reductase OS=Lactobacillus salivarius (strain UCC118) GN=proA PE=3 SV=1 | 10 | 406 | 5.0E-80 |
| sp|B0T315|PROA_CAUSK | Gamma-glutamyl phosphate reductase OS=Caulobacter sp. (strain K31) GN=proA PE=3 SV=2 | 14 | 406 | 6.0E-80 |
| sp|Q3A1E0|PROA_PELCD | Gamma-glutamyl phosphate reductase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=proA PE=3 SV=1 | 9 | 406 | 7.0E-80 |
| sp|Q2S354|PROA_SALRD | Gamma-glutamyl phosphate reductase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=proA PE=3 SV=1 | 22 | 421 | 7.0E-80 |
| sp|C1DMQ0|PROA_AZOVD | Gamma-glutamyl phosphate reductase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=proA PE=3 SV=1 | 80 | 404 | 8.0E-80 |
| sp|B2UX78|PROA_CLOBA | Gamma-glutamyl phosphate reductase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=proA PE=3 SV=1 | 15 | 406 | 1.0E-79 |
| sp|Q47UQ0|PROA_COLP3 | Gamma-glutamyl phosphate reductase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=proA PE=3 SV=1 | 3 | 406 | 2.0E-79 |
| sp|B1J133|PROA_PSEPW | Gamma-glutamyl phosphate reductase OS=Pseudomonas putida (strain W619) GN=proA PE=3 SV=1 | 11 | 406 | 2.0E-79 |
| sp|B9LE47|PROA_CHLSY | Gamma-glutamyl phosphate reductase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=proA PE=3 SV=1 | 9 | 405 | 2.0E-79 |
| sp|A9WBM7|PROA_CHLAA | Gamma-glutamyl phosphate reductase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=proA PE=3 SV=1 | 9 | 405 | 2.0E-79 |
| sp|A7HT65|PROA_PARL1 | Gamma-glutamyl phosphate reductase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=proA PE=3 SV=1 | 9 | 406 | 3.0E-79 |
| sp|B0RS59|PROA_XANCB | Gamma-glutamyl phosphate reductase OS=Xanthomonas campestris pv. campestris (strain B100) GN=proA PE=3 SV=1 | 48 | 406 | 3.0E-79 |
| sp|B0K9C5|PROA_THEP3 | Gamma-glutamyl phosphate reductase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=proA PE=3 SV=1 | 31 | 406 | 4.0E-79 |
| sp|A1WGI4|PROA_VEREI | Gamma-glutamyl phosphate reductase OS=Verminephrobacter eiseniae (strain EF01-2) GN=proA PE=3 SV=2 | 15 | 404 | 4.0E-79 |
| sp|B8F6K8|PROA_HAEPS | Gamma-glutamyl phosphate reductase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=proA PE=3 SV=1 | 10 | 405 | 4.0E-79 |
| sp|B2SHW6|PROA_XANOP | Gamma-glutamyl phosphate reductase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=proA PE=3 SV=1 | 48 | 406 | 4.0E-79 |
| sp|Q2P2G1|PROA_XANOM | Gamma-glutamyl phosphate reductase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=proA PE=3 SV=1 | 48 | 406 | 4.0E-79 |
| sp|Q1I4F0|PROA_PSEE4 | Gamma-glutamyl phosphate reductase OS=Pseudomonas entomophila (strain L48) GN=proA PE=3 SV=1 | 11 | 406 | 5.0E-79 |
| sp|C4LBK4|PROA_TOLAT | Gamma-glutamyl phosphate reductase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=proA PE=3 SV=1 | 11 | 405 | 6.0E-79 |
| sp|A1TVU4|PROA_ACIAC | Gamma-glutamyl phosphate reductase OS=Acidovorax citrulli (strain AAC00-1) GN=proA PE=3 SV=1 | 80 | 404 | 7.0E-79 |
| sp|A1VTR9|PROA_POLNA | Gamma-glutamyl phosphate reductase OS=Polaromonas naphthalenivorans (strain CJ2) GN=proA PE=3 SV=1 | 15 | 403 | 8.0E-79 |
| sp|Q122S5|PROA_POLSJ | Gamma-glutamyl phosphate reductase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=proA PE=3 SV=1 | 9 | 404 | 8.0E-79 |
| sp|B0K0T2|PROA_THEPX | Gamma-glutamyl phosphate reductase OS=Thermoanaerobacter sp. (strain X514) GN=proA PE=3 SV=1 | 31 | 406 | 1.0E-78 |
| sp|A5W9J6|PROA_PSEP1 | Gamma-glutamyl phosphate reductase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=proA PE=3 SV=1 | 11 | 406 | 2.0E-78 |
| sp|Q6G4Z0|PROA_BARHE | Gamma-glutamyl phosphate reductase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=proA PE=3 SV=1 | 9 | 406 | 2.0E-78 |
| sp|Q1IS80|PROA_KORVE | Gamma-glutamyl phosphate reductase OS=Koribacter versatilis (strain Ellin345) GN=proA PE=3 SV=1 | 25 | 406 | 2.0E-78 |
| sp|Q5FRT2|PROA_GLUOX | Gamma-glutamyl phosphate reductase OS=Gluconobacter oxydans (strain 621H) GN=proA PE=3 SV=1 | 11 | 406 | 2.0E-78 |
| sp|A2SCE2|PROA_METPP | Gamma-glutamyl phosphate reductase OS=Methylibium petroleiphilum (strain PM1) GN=proA PE=3 SV=1 | 80 | 403 | 2.0E-78 |
| sp|A9VK31|PROA_BACWK | Gamma-glutamyl phosphate reductase OS=Bacillus weihenstephanensis (strain KBAB4) GN=proA PE=3 SV=1 | 10 | 406 | 2.0E-78 |
| sp|B1L9J9|PROA_THESQ | Gamma-glutamyl phosphate reductase OS=Thermotoga sp. (strain RQ2) GN=proA PE=3 SV=1 | 10 | 406 | 3.0E-78 |
| sp|Q9WYC9|PROA_THEMA | Gamma-glutamyl phosphate reductase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=proA PE=1 SV=1 | 10 | 406 | 3.0E-78 |
| sp|Q5GZF2|PROA_XANOR | Gamma-glutamyl phosphate reductase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=proA PE=3 SV=2 | 48 | 406 | 4.0E-78 |
| sp|A8H764|PROA_SHEPA | Gamma-glutamyl phosphate reductase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=proA PE=3 SV=1 | 15 | 405 | 4.0E-78 |
| sp|B8FM70|PROA_DESAA | Gamma-glutamyl phosphate reductase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=proA PE=3 SV=1 | 10 | 406 | 5.0E-78 |
| sp|Q4QJW6|PROA_HAEI8 | Gamma-glutamyl phosphate reductase OS=Haemophilus influenzae (strain 86-028NP) GN=proA PE=3 SV=1 | 9 | 405 | 6.0E-78 |
| sp|A5URC6|PROA_ROSS1 | Gamma-glutamyl phosphate reductase OS=Roseiflexus sp. (strain RS-1) GN=proA PE=3 SV=1 | 9 | 404 | 7.0E-78 |
| sp|B9MK80|PROA_CALBD | Gamma-glutamyl phosphate reductase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=proA PE=3 SV=1 | 10 | 417 | 7.0E-78 |
| sp|Q3K693|PROA_PSEPF | Gamma-glutamyl phosphate reductase OS=Pseudomonas fluorescens (strain Pf0-1) GN=proA PE=3 SV=1 | 14 | 406 | 8.0E-78 |
| sp|Q0AEA6|PROA_NITEC | Gamma-glutamyl phosphate reductase OS=Nitrosomonas eutropha (strain C91) GN=proA PE=3 SV=1 | 28 | 404 | 9.0E-78 |
| sp|B0TQC4|PROA_SHEHH | Gamma-glutamyl phosphate reductase OS=Shewanella halifaxensis (strain HAW-EB4) GN=proA PE=3 SV=1 | 15 | 405 | 1.0E-77 |
| sp|B4RLE6|PROA_NEIG2 | Gamma-glutamyl phosphate reductase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=proA PE=3 SV=1 | 13 | 406 | 1.0E-77 |
| sp|Q5F8D3|PROA_NEIG1 | Gamma-glutamyl phosphate reductase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=proA PE=3 SV=1 | 13 | 406 | 1.0E-77 |
| sp|C6E7L9|PROA_GEOSM | Gamma-glutamyl phosphate reductase OS=Geobacter sp. (strain M21) GN=proA PE=3 SV=1 | 11 | 417 | 1.0E-77 |
| sp|B2UC98|PROA_RALPJ | Gamma-glutamyl phosphate reductase OS=Ralstonia pickettii (strain 12J) GN=proA PE=3 SV=1 | 15 | 403 | 1.0E-77 |
| sp|Q7MN58|PROA_VIBVY | Gamma-glutamyl phosphate reductase OS=Vibrio vulnificus (strain YJ016) GN=proA PE=3 SV=1 | 11 | 405 | 1.0E-77 |
| sp|B9J498|PROA_BACCQ | Gamma-glutamyl phosphate reductase OS=Bacillus cereus (strain Q1) GN=proA PE=3 SV=1 | 10 | 406 | 1.0E-77 |
| sp|B7HVK6|PROA_BACC7 | Gamma-glutamyl phosphate reductase OS=Bacillus cereus (strain AH187) GN=proA PE=3 SV=1 | 10 | 406 | 1.0E-77 |
| sp|A5UF66|PROA_HAEIG | Gamma-glutamyl phosphate reductase OS=Haemophilus influenzae (strain PittGG) GN=proA PE=3 SV=1 | 9 | 405 | 1.0E-77 |
| sp|A5IKB6|PROA_THEP1 | Gamma-glutamyl phosphate reductase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=proA PE=3 SV=1 | 10 | 406 | 1.0E-77 |
| sp|B9JER3|PROA_AGRRK | Gamma-glutamyl phosphate reductase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=proA PE=3 SV=1 | 10 | 406 | 1.0E-77 |
| sp|C4Z9V4|PROA_EUBR3 | Gamma-glutamyl phosphate reductase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=proA PE=3 SV=1 | 9 | 417 | 1.0E-77 |
| sp|A3N3P3|PROA_ACTP2 | Gamma-glutamyl phosphate reductase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=proA PE=3 SV=1 | 11 | 405 | 2.0E-77 |
| sp|Q8DF94|PROA_VIBVU | Gamma-glutamyl phosphate reductase OS=Vibrio vulnificus (strain CMCP6) GN=proA PE=3 SV=1 | 11 | 405 | 2.0E-77 |
| sp|B3H321|PROA_ACTP7 | Gamma-glutamyl phosphate reductase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=proA PE=3 SV=1 | 11 | 405 | 2.0E-77 |
| sp|B0BTX9|PROA_ACTPJ | Gamma-glutamyl phosphate reductase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=proA PE=3 SV=1 | 11 | 405 | 2.0E-77 |
| sp|A5G906|PROA_GEOUR | Gamma-glutamyl phosphate reductase OS=Geobacter uraniireducens (strain Rf4) GN=proA PE=3 SV=1 | 10 | 406 | 2.0E-77 |
| sp|P45121|PROA_HAEIN | Gamma-glutamyl phosphate reductase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=proA PE=3 SV=1 | 9 | 405 | 3.0E-77 |
| sp|A8FYU6|PROA_SHESH | Gamma-glutamyl phosphate reductase OS=Shewanella sediminis (strain HAW-EB3) GN=proA PE=3 SV=1 | 9 | 405 | 3.0E-77 |
| sp|Q2KXE0|PROA_BORA1 | Gamma-glutamyl phosphate reductase OS=Bordetella avium (strain 197N) GN=proA PE=3 SV=1 | 15 | 406 | 3.0E-77 |
| sp|Q1GZB2|PROA_METFK | Gamma-glutamyl phosphate reductase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=proA PE=3 SV=1 | 9 | 404 | 5.0E-77 |
| sp|Q2N9V1|PROA_ERYLH | Gamma-glutamyl phosphate reductase OS=Erythrobacter litoralis (strain HTCC2594) GN=proA PE=3 SV=1 | 9 | 406 | 5.0E-77 |
| sp|Q839W3|PROA_ENTFA | Gamma-glutamyl phosphate reductase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=proA PE=3 SV=1 | 9 | 406 | 5.0E-77 |
| sp|Q035M3|PROA_LACC3 | Gamma-glutamyl phosphate reductase OS=Lactobacillus casei (strain ATCC 334) GN=proA PE=3 SV=1 | 1 | 406 | 6.0E-77 |
| sp|Q65IS9|PROA2_BACLD | Gamma-glutamyl phosphate reductase 2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=proA2 PE=3 SV=1 | 9 | 404 | 7.0E-77 |
| sp|Q9KPT9|PROA_VIBCH | Gamma-glutamyl phosphate reductase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=proA PE=3 SV=2 | 11 | 405 | 7.0E-77 |
| sp|A5F602|PROA_VIBC3 | Gamma-glutamyl phosphate reductase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=proA PE=3 SV=2 | 11 | 405 | 7.0E-77 |
| sp|B3WA82|PROA_LACCB | Gamma-glutamyl phosphate reductase OS=Lactobacillus casei (strain BL23) GN=proA PE=3 SV=1 | 1 | 406 | 7.0E-77 |
| sp|Q5WH54|PROA_BACSK | Gamma-glutamyl phosphate reductase OS=Bacillus clausii (strain KSM-K16) GN=proA PE=3 SV=1 | 7 | 406 | 9.0E-77 |
| sp|Q67LC2|PROA_SYMTH | Gamma-glutamyl phosphate reductase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=proA PE=3 SV=1 | 26 | 406 | 1.0E-76 |
| sp|B7VJB0|PROA_VIBTL | Gamma-glutamyl phosphate reductase OS=Vibrio tasmaniensis (strain LGP32) GN=proA PE=3 SV=1 | 1 | 405 | 1.0E-76 |
| sp|A5UBQ2|PROA_HAEIE | Gamma-glutamyl phosphate reductase OS=Haemophilus influenzae (strain PittEE) GN=proA PE=3 SV=1 | 9 | 405 | 1.0E-76 |
| sp|C0QS00|PROA_PERMH | Gamma-glutamyl phosphate reductase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=proA PE=3 SV=1 | 9 | 406 | 1.0E-76 |
| sp|A4XK60|PROA_CALS8 | Gamma-glutamyl phosphate reductase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=proA PE=3 SV=1 | 12 | 406 | 2.0E-76 |
| sp|B8E0D2|PROA_DICTD | Gamma-glutamyl phosphate reductase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=proA PE=3 SV=1 | 15 | 406 | 2.0E-76 |
| sp|B5EEI4|PROA_GEOBB | Gamma-glutamyl phosphate reductase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=proA PE=3 SV=1 | 11 | 417 | 2.0E-76 |
| sp|A4YKF1|PROA_BRASO | Gamma-glutamyl phosphate reductase OS=Bradyrhizobium sp. (strain ORS278) GN=proA PE=3 SV=1 | 30 | 406 | 2.0E-76 |
| sp|Q39QR2|PROA_GEOMG | Gamma-glutamyl phosphate reductase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=proA PE=3 SV=1 | 22 | 406 | 2.0E-76 |
| sp|B2G5W8|PROA_LACRJ | Gamma-glutamyl phosphate reductase OS=Lactobacillus reuteri (strain JCM 1112) GN=proA PE=3 SV=1 | 11 | 406 | 2.0E-76 |
| sp|A5VIE0|PROA_LACRD | Gamma-glutamyl phosphate reductase OS=Lactobacillus reuteri (strain DSM 20016) GN=proA PE=3 SV=1 | 11 | 406 | 2.0E-76 |
| sp|Q9A2X6|PROA_CAUCR | Gamma-glutamyl phosphate reductase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=proA PE=3 SV=1 | 15 | 406 | 3.0E-76 |
| sp|Q5QY68|PROA_IDILO | Gamma-glutamyl phosphate reductase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=proA PE=3 SV=1 | 8 | 406 | 3.0E-76 |
| sp|Q9JZG3|PROA_NEIMB | Gamma-glutamyl phosphate reductase OS=Neisseria meningitidis serogroup B (strain MC58) GN=proA PE=3 SV=1 | 13 | 406 | 3.0E-76 |
| sp|Q5NLX5|PROA_ZYMMO | Gamma-glutamyl phosphate reductase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=proA PE=3 SV=1 | 11 | 406 | 4.0E-76 |
| sp|Q7WH30|PROA_BORBR | Gamma-glutamyl phosphate reductase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=proA PE=3 SV=1 | 1 | 406 | 5.0E-76 |
| sp|A1WCP4|PROA_ACISJ | Gamma-glutamyl phosphate reductase OS=Acidovorax sp. (strain JS42) GN=proA PE=3 SV=1 | 52 | 404 | 5.0E-76 |
| sp|Q735X3|PROA_BACC1 | Gamma-glutamyl phosphate reductase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=proA PE=3 SV=1 | 10 | 406 | 5.0E-76 |
| sp|B5YEQ8|PROA_DICT6 | Gamma-glutamyl phosphate reductase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=proA PE=3 SV=1 | 15 | 406 | 6.0E-76 |
| sp|A5E961|PROA_BRASB | Gamma-glutamyl phosphate reductase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=proA PE=3 SV=1 | 30 | 406 | 6.0E-76 |
| sp|B5YK66|PROA_THEYD | Gamma-glutamyl phosphate reductase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=proA PE=3 SV=1 | 12 | 406 | 6.0E-76 |
| sp|B9MH63|PROA_ACIET | Gamma-glutamyl phosphate reductase OS=Acidovorax ebreus (strain TPSY) GN=proA PE=3 SV=1 | 52 | 404 | 8.0E-76 |
| sp|Q6G0S6|PROA_BARQU | Gamma-glutamyl phosphate reductase OS=Bartonella quintana (strain Toulouse) GN=proA PE=3 SV=1 | 9 | 406 | 9.0E-76 |
| sp|B8ZP35|PROA_STRPJ | Gamma-glutamyl phosphate reductase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=proA PE=3 SV=1 | 80 | 406 | 9.0E-76 |
| sp|Q47MW1|PROA_THEFY | Gamma-glutamyl phosphate reductase OS=Thermobifida fusca (strain YX) GN=proA PE=3 SV=2 | 25 | 404 | 9.0E-76 |
| sp|A4VTT5|PROA_STRSY | Gamma-glutamyl phosphate reductase OS=Streptococcus suis (strain 05ZYH33) GN=proA PE=3 SV=1 | 15 | 404 | 9.0E-76 |
| sp|A4W028|PROA_STRS2 | Gamma-glutamyl phosphate reductase OS=Streptococcus suis (strain 98HAH33) GN=proA PE=3 SV=1 | 15 | 404 | 9.0E-76 |
| sp|Q13DN0|PROA_RHOPS | Gamma-glutamyl phosphate reductase OS=Rhodopseudomonas palustris (strain BisB5) GN=proA PE=3 SV=1 | 30 | 406 | 1.0E-75 |
| sp|Q8XVT6|PROA_RALSO | Gamma-glutamyl phosphate reductase OS=Ralstonia solanacearum (strain GMI1000) GN=proA PE=3 SV=1 | 15 | 403 | 1.0E-75 |
| sp|B2IP88|PROA_STRPS | Gamma-glutamyl phosphate reductase OS=Streptococcus pneumoniae (strain CGSP14) GN=proA PE=3 SV=1 | 80 | 406 | 2.0E-75 |
| sp|B0U111|PROA_FRAP2 | Gamma-glutamyl phosphate reductase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=proA PE=3 SV=2 | 10 | 406 | 2.0E-75 |
| sp|Q24XR6|PROA_DESHY | Gamma-glutamyl phosphate reductase OS=Desulfitobacterium hafniense (strain Y51) GN=proA PE=3 SV=1 | 11 | 404 | 2.0E-75 |
| sp|C1EZ15|PROA_BACC3 | Gamma-glutamyl phosphate reductase OS=Bacillus cereus (strain 03BB102) GN=proA PE=3 SV=1 | 10 | 406 | 2.0E-75 |
| sp|Q7W9M7|PROA_BORPA | Gamma-glutamyl phosphate reductase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=proA PE=3 SV=1 | 1 | 406 | 2.0E-75 |
| sp|B1KD27|PROA_SHEWM | Gamma-glutamyl phosphate reductase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=proA PE=3 SV=1 | 9 | 405 | 2.0E-75 |
| sp|B9M0D6|PROA_GEODF | Gamma-glutamyl phosphate reductase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=proA PE=3 SV=1 | 22 | 406 | 2.0E-75 |
| sp|A1SYT9|PROA_PSYIN | Gamma-glutamyl phosphate reductase OS=Psychromonas ingrahamii (strain 37) GN=proA PE=3 SV=1 | 9 | 399 | 2.0E-75 |
| sp|Q1QQT7|PROA_NITHX | Gamma-glutamyl phosphate reductase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=proA PE=3 SV=1 | 3 | 406 | 2.0E-75 |
| sp|C1CDS9|PROA_STRZJ | Gamma-glutamyl phosphate reductase OS=Streptococcus pneumoniae (strain JJA) GN=proA PE=3 SV=1 | 80 | 406 | 2.0E-75 |
| sp|Q3ZYH9|PROA_DEHMC | Gamma-glutamyl phosphate reductase OS=Dehalococcoides mccartyi (strain CBDB1) GN=proA PE=3 SV=1 | 9 | 417 | 3.0E-75 |
| sp|A8MFQ5|PROA_ALKOO | Gamma-glutamyl phosphate reductase OS=Alkaliphilus oremlandii (strain OhILAs) GN=proA PE=3 SV=1 | 16 | 406 | 3.0E-75 |
| sp|Q82C81|PROA_STRAW | Gamma-glutamyl phosphate reductase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=proA PE=3 SV=1 | 28 | 404 | 3.0E-75 |
| sp|A5FQ48|PROA_DEHMB | Gamma-glutamyl phosphate reductase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=proA PE=3 SV=1 | 9 | 417 | 3.0E-75 |
| sp|A0AI64|PROA_LISW6 | Gamma-glutamyl phosphate reductase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=proA PE=3 SV=1 | 14 | 406 | 3.0E-75 |
| sp|Q6AK09|PROA_DESPS | Gamma-glutamyl phosphate reductase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=proA PE=3 SV=1 | 10 | 406 | 4.0E-75 |
| sp|Q2K2X4|PROA_RHIEC | Gamma-glutamyl phosphate reductase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=proA PE=3 SV=1 | 10 | 406 | 4.0E-75 |
| sp|Q2GCB4|PROA_NOVAD | Gamma-glutamyl phosphate reductase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=proA PE=3 SV=1 | 9 | 406 | 4.0E-75 |
| sp|Q6HHC2|PROA_BACHK | Gamma-glutamyl phosphate reductase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=proA PE=3 SV=1 | 15 | 406 | 4.0E-75 |
| sp|B7JD15|PROA_BACC0 | Gamma-glutamyl phosphate reductase OS=Bacillus cereus (strain AH820) GN=proA PE=3 SV=1 | 15 | 406 | 4.0E-75 |
| sp|C1CRW1|PROA_STRZT | Gamma-glutamyl phosphate reductase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=proA PE=3 SV=1 | 80 | 406 | 4.0E-75 |
| sp|Q8DQ60|PROA_STRR6 | Gamma-glutamyl phosphate reductase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=proA PE=3 SV=1 | 80 | 406 | 4.0E-75 |
| sp|Q04KZ2|PROA_STRP2 | Gamma-glutamyl phosphate reductase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=proA PE=3 SV=1 | 80 | 406 | 4.0E-75 |
| sp|Q13U85|PROA_BURXL | Gamma-glutamyl phosphate reductase OS=Burkholderia xenovorans (strain LB400) GN=proA PE=3 SV=1 | 10 | 403 | 5.0E-75 |
| sp|C1C6R4|PROA_STRP7 | Gamma-glutamyl phosphate reductase OS=Streptococcus pneumoniae (strain 70585) GN=proA PE=3 SV=1 | 80 | 406 | 5.0E-75 |
| sp|B3PRZ5|PROA_RHIE6 | Gamma-glutamyl phosphate reductase OS=Rhizobium etli (strain CIAT 652) GN=proA PE=3 SV=1 | 10 | 406 | 5.0E-75 |
| sp|Q7VWZ0|PROA_BORPE | Gamma-glutamyl phosphate reductase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=proA PE=3 SV=1 | 1 | 406 | 5.0E-75 |
| sp|Q165Y8|PROA_ROSDO | Gamma-glutamyl phosphate reductase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=proA PE=3 SV=1 | 10 | 404 | 6.0E-75 |
| sp|Q8CUQ4|PROA_OCEIH | Gamma-glutamyl phosphate reductase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=proA PE=3 SV=1 | 10 | 406 | 6.0E-75 |
| sp|Q5E6W0|PROA_VIBF1 | Gamma-glutamyl phosphate reductase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=proA PE=3 SV=2 | 22 | 405 | 6.0E-75 |
| sp|C1CK18|PROA_STRZP | Gamma-glutamyl phosphate reductase OS=Streptococcus pneumoniae (strain P1031) GN=proA PE=3 SV=1 | 80 | 406 | 7.0E-75 |
| sp|Q3Z6Z9|PROA_DEHM1 | Gamma-glutamyl phosphate reductase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=proA PE=3 SV=1 | 9 | 406 | 8.0E-75 |
| sp|Q97R94|PROA_STRPN | Gamma-glutamyl phosphate reductase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=proA PE=3 SV=1 | 80 | 406 | 8.0E-75 |
| sp|B4U4K6|PROA_STREM | Gamma-glutamyl phosphate reductase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=proA PE=3 SV=1 | 9 | 406 | 1.0E-74 |
| sp|Q97E62|PROA_CLOAB | Gamma-glutamyl phosphate reductase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=proA PE=3 SV=1 | 11 | 406 | 1.0E-74 |
| sp|A8ZRY3|PROA_DESOH | Gamma-glutamyl phosphate reductase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=proA PE=3 SV=1 | 48 | 406 | 1.0E-74 |
| sp|Q639W9|PROA_BACCZ | Gamma-glutamyl phosphate reductase OS=Bacillus cereus (strain ZK / E33L) GN=proA PE=3 SV=1 | 15 | 406 | 1.0E-74 |
| sp|Q1MA74|PROA_RHIL3 | Gamma-glutamyl phosphate reductase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=proA PE=3 SV=1 | 10 | 406 | 2.0E-74 |
| sp|Q3B2U3|PROA_CHLL7 | Gamma-glutamyl phosphate reductase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=proA PE=3 SV=2 | 1 | 406 | 2.0E-74 |
| sp|B9JUH7|PROA_AGRVS | Gamma-glutamyl phosphate reductase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=proA PE=3 SV=1 | 10 | 406 | 2.0E-74 |
| sp|Q21D00|PROA_RHOPB | Gamma-glutamyl phosphate reductase OS=Rhodopseudomonas palustris (strain BisB18) GN=proA PE=3 SV=1 | 28 | 406 | 2.0E-74 |
| sp|A4X1X0|PROA_SALTO | Gamma-glutamyl phosphate reductase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=proA PE=3 SV=1 | 29 | 406 | 2.0E-74 |
| sp|A7NSB7|PROA_ROSCS | Gamma-glutamyl phosphate reductase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=proA PE=3 SV=1 | 42 | 404 | 2.0E-74 |
| sp|A5V8T0|PROA_SPHWW | Gamma-glutamyl phosphate reductase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=proA PE=3 SV=1 | 80 | 406 | 2.0E-74 |
| sp|A8LK12|PROA_DINSH | Gamma-glutamyl phosphate reductase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=proA PE=3 SV=1 | 43 | 404 | 2.0E-74 |
| sp|A9C1G5|PROA_DELAS | Gamma-glutamyl phosphate reductase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=proA PE=3 SV=1 | 11 | 404 | 2.0E-74 |
| sp|B5FBJ5|PROA_VIBFM | Gamma-glutamyl phosphate reductase OS=Vibrio fischeri (strain MJ11) GN=proA PE=3 SV=1 | 22 | 405 | 2.0E-74 |
| sp|A5CR34|PROA_CLAM3 | Gamma-glutamyl phosphate reductase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=proA PE=3 SV=1 | 9 | 406 | 3.0E-74 |
| sp|B7GJH1|PROA_ANOFW | Gamma-glutamyl phosphate reductase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=proA PE=3 SV=1 | 12 | 417 | 3.0E-74 |
| sp|Q2J3J6|PROA_RHOP2 | Gamma-glutamyl phosphate reductase OS=Rhodopseudomonas palustris (strain HaA2) GN=proA PE=3 SV=1 | 26 | 406 | 4.0E-74 |
| sp|Q3IXX7|PROA_RHOS4 | Gamma-glutamyl phosphate reductase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=proA PE=3 SV=1 | 46 | 404 | 4.0E-74 |
| sp|B7H673|PROA_BACC4 | Gamma-glutamyl phosphate reductase OS=Bacillus cereus (strain B4264) GN=proA PE=3 SV=1 | 15 | 406 | 4.0E-74 |
| sp|Q5LRY6|PROA_RUEPO | Gamma-glutamyl phosphate reductase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=proA PE=3 SV=1 | 32 | 404 | 4.0E-74 |
| sp|A3PQJ2|PROA_RHOS1 | Gamma-glutamyl phosphate reductase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=proA PE=3 SV=1 | 46 | 404 | 4.0E-74 |
| sp|B1IBA0|PROA_STRPI | Gamma-glutamyl phosphate reductase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=proA PE=3 SV=1 | 80 | 406 | 4.0E-74 |
| sp|B2SYN3|PROA_BURPP | Gamma-glutamyl phosphate reductase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=proA PE=3 SV=1 | 10 | 403 | 6.0E-74 |
| sp|A1KTV4|PROA_NEIMF | Gamma-glutamyl phosphate reductase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=proA PE=3 SV=1 | 13 | 406 | 6.0E-74 |
| sp|Q3BSJ1|PROA_XANC5 | Gamma-glutamyl phosphate reductase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=proA PE=3 SV=1 | 80 | 406 | 6.0E-74 |
| sp|Q8UBS1|PROA_AGRFC | Gamma-glutamyl phosphate reductase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=proA PE=3 SV=2 | 11 | 406 | 7.0E-74 |
| sp|Q5SH02|PROA_THET8 | Gamma-glutamyl phosphate reductase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=proA PE=3 SV=1 | 15 | 406 | 8.0E-74 |
| sp|B9DV79|PROA_STRU0 | Gamma-glutamyl phosphate reductase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=proA PE=3 SV=1 | 9 | 406 | 8.0E-74 |
| sp|Q5KYA2|PROA_GEOKA | Gamma-glutamyl phosphate reductase OS=Geobacillus kaustophilus (strain HTA426) GN=proA PE=3 SV=1 | 10 | 417 | 9.0E-74 |
| sp|Q1GHC8|PROA_RUEST | Gamma-glutamyl phosphate reductase OS=Ruegeria sp. (strain TM1040) GN=proA PE=3 SV=2 | 9 | 404 | 1.0E-73 |
| sp|B7ILK1|PROA_BACC2 | Gamma-glutamyl phosphate reductase OS=Bacillus cereus (strain G9842) GN=proA PE=3 SV=1 | 15 | 406 | 1.0E-73 |
| sp|B9KW06|PROA_RHOSK | Gamma-glutamyl phosphate reductase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=proA PE=3 SV=1 | 46 | 404 | 1.0E-73 |
| sp|Q8PK35|PROA_XANAC | Gamma-glutamyl phosphate reductase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=proA PE=3 SV=1 | 80 | 406 | 1.0E-73 |
| sp|P54903|PROA_THET2 | Gamma-glutamyl phosphate reductase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=proA PE=3 SV=3 | 15 | 406 | 1.0E-73 |
| sp|Q9JUK8|PROA_NEIMA | Gamma-glutamyl phosphate reductase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=proA PE=3 SV=1 | 13 | 406 | 2.0E-73 |
| sp|Q1GVM0|PROA_SPHAL | Gamma-glutamyl phosphate reductase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=proA PE=3 SV=1 | 10 | 406 | 3.0E-73 |
| sp|Q92CE5|PROA_LISIN | Gamma-glutamyl phosphate reductase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=proA PE=3 SV=1 | 13 | 406 | 3.0E-73 |
| sp|C6BSC1|PROA_DESAD | Gamma-glutamyl phosphate reductase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=proA PE=3 SV=1 | 11 | 405 | 4.0E-73 |
| sp|B8FUB6|PROA_DESHD | Gamma-glutamyl phosphate reductase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=proA PE=3 SV=1 | 11 | 404 | 5.0E-73 |
| sp|Q6AFX9|PROA_LEIXX | Gamma-glutamyl phosphate reductase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=proA PE=3 SV=1 | 13 | 406 | 5.0E-73 |
| sp|Q98EZ5|PROA_RHILO | Gamma-glutamyl phosphate reductase OS=Rhizobium loti (strain MAFF303099) GN=proA PE=3 SV=1 | 22 | 406 | 5.0E-73 |
| sp|B5ZUE5|PROA_RHILW | Gamma-glutamyl phosphate reductase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=proA PE=3 SV=1 | 10 | 406 | 6.0E-73 |
| sp|B0UMS9|PROA_METS4 | Gamma-glutamyl phosphate reductase OS=Methylobacterium sp. (strain 4-46) GN=proA PE=3 SV=1 | 48 | 406 | 7.0E-73 |
| sp|B2S2U7|PROA_TREPS | Gamma-glutamyl phosphate reductase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=proA PE=3 SV=1 | 10 | 406 | 1.0E-72 |
| sp|P74935|PROA_TREPA | Gamma-glutamyl phosphate reductase OS=Treponema pallidum (strain Nichols) GN=proA PE=3 SV=3 | 10 | 406 | 1.0E-72 |
| sp|A4IPN4|PROA_GEOTN | Gamma-glutamyl phosphate reductase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=proA PE=3 SV=1 | 10 | 417 | 1.0E-72 |
| sp|Q89X85|PROA_BRADU | Gamma-glutamyl phosphate reductase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=proA PE=3 SV=1 | 70 | 406 | 1.0E-72 |
| sp|Q8EHU1|PROA_SHEON | Gamma-glutamyl phosphate reductase OS=Shewanella oneidensis (strain MR-1) GN=proA PE=3 SV=1 | 9 | 409 | 1.0E-72 |
| sp|Q93Q55|PROA_LISMO | Gamma-glutamyl phosphate reductase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=proA PE=3 SV=1 | 13 | 406 | 2.0E-72 |
| sp|A6LE74|PROA_PARD8 | Gamma-glutamyl phosphate reductase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=proA PE=3 SV=1 | 7 | 406 | 2.0E-72 |
| sp|B8D0Y6|PROA_HALOH | Gamma-glutamyl phosphate reductase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=proA PE=3 SV=1 | 12 | 406 | 2.0E-72 |
| sp|C5D2V2|PROA_GEOSW | Gamma-glutamyl phosphate reductase OS=Geobacillus sp. (strain WCH70) GN=proA PE=3 SV=1 | 12 | 417 | 2.0E-72 |
| sp|Q8FYM3|PROA_BRUSU | Gamma-glutamyl phosphate reductase OS=Brucella suis biovar 1 (strain 1330) GN=proA PE=3 SV=1 | 3 | 406 | 3.0E-72 |
| sp|Q57B47|PROA_BRUAB | Gamma-glutamyl phosphate reductase OS=Brucella abortus biovar 1 (strain 9-941) GN=proA PE=3 SV=1 | 3 | 406 | 3.0E-72 |
| sp|Q2YLI7|PROA_BRUA2 | Gamma-glutamyl phosphate reductase OS=Brucella abortus (strain 2308) GN=proA PE=3 SV=1 | 3 | 406 | 3.0E-72 |
| sp|Q8P8K3|PROA_XANCP | Gamma-glutamyl phosphate reductase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=proA PE=3 SV=1 | 9 | 406 | 4.0E-72 |
| sp|A9M880|PROA_BRUC2 | Gamma-glutamyl phosphate reductase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=proA PE=3 SV=1 | 3 | 406 | 4.0E-72 |
| sp|Q65KU7|PROA1_BACLD | Gamma-glutamyl phosphate reductase 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=proA1 PE=3 SV=1 | 30 | 406 | 4.0E-72 |
| sp|A5VSI3|PROA_BRUO2 | Gamma-glutamyl phosphate reductase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=proA PE=3 SV=1 | 3 | 406 | 5.0E-72 |
| sp|Q8YJ78|PROA_BRUME | Gamma-glutamyl phosphate reductase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=proA PE=3 SV=2 | 3 | 406 | 5.0E-72 |
| sp|Q0AL88|PROA_MARMM | Gamma-glutamyl phosphate reductase OS=Maricaulis maris (strain MCS10) GN=proA PE=3 SV=1 | 9 | 406 | 5.0E-72 |
| sp|C0RF92|PROA_BRUMB | Gamma-glutamyl phosphate reductase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=proA PE=3 SV=1 | 3 | 406 | 5.0E-72 |
| sp|Q7UNV2|PROA_RHOBA | Gamma-glutamyl phosphate reductase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=proA PE=3 SV=1 | 10 | 404 | 6.0E-72 |
| sp|B5E435|PROA_STRP4 | Gamma-glutamyl phosphate reductase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=proA PE=3 SV=1 | 31 | 406 | 6.0E-72 |
| sp|A1URN6|PROA_BARBK | Gamma-glutamyl phosphate reductase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=proA PE=3 SV=1 | 15 | 406 | 7.0E-72 |
| sp|Q4UVI0|PROA_XANC8 | Gamma-glutamyl phosphate reductase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=proA PE=3 SV=1 | 9 | 406 | 7.0E-72 |
| sp|Q8E783|PROA_STRA3 | Gamma-glutamyl phosphate reductase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=proA PE=3 SV=1 | 9 | 406 | 7.0E-72 |
| sp|Q07V09|PROA_RHOP5 | Gamma-glutamyl phosphate reductase OS=Rhodopseudomonas palustris (strain BisA53) GN=proA PE=3 SV=1 | 10 | 406 | 8.0E-72 |
| sp|A6TUA0|PROA_ALKMQ | Gamma-glutamyl phosphate reductase OS=Alkaliphilus metalliredigens (strain QYMF) GN=proA PE=3 SV=1 | 10 | 406 | 1.0E-71 |
| sp|Q890J4|PROA_LACPL | Gamma-glutamyl phosphate reductase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=proA PE=3 SV=1 | 9 | 406 | 1.0E-71 |
| sp|Q8E1R9|PROA_STRA5 | Gamma-glutamyl phosphate reductase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=proA PE=3 SV=1 | 9 | 406 | 1.0E-71 |
| sp|Q3K395|PROA_STRA1 | Gamma-glutamyl phosphate reductase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=proA PE=3 SV=1 | 9 | 406 | 1.0E-71 |
| sp|Q6A9H6|PROA_PROAC | Gamma-glutamyl phosphate reductase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=proA PE=3 SV=1 | 10 | 406 | 1.0E-71 |
| sp|B1VXE5|PROA_STRGG | Gamma-glutamyl phosphate reductase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=proA PE=3 SV=1 | 25 | 404 | 3.0E-71 |
| sp|A6WXS2|PROA_OCHA4 | Gamma-glutamyl phosphate reductase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=proA PE=3 SV=1 | 10 | 406 | 3.0E-71 |
| sp|A6UDV8|PROA_SINMW | Gamma-glutamyl phosphate reductase OS=Sinorhizobium medicae (strain WSM419) GN=proA PE=3 SV=1 | 10 | 406 | 3.0E-71 |
| sp|B0U208|PROA_XYLFM | Gamma-glutamyl phosphate reductase OS=Xylella fastidiosa (strain M12) GN=proA PE=3 SV=1 | 80 | 406 | 3.0E-71 |
| sp|A0LPG2|PROA_SYNFM | Gamma-glutamyl phosphate reductase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=proA PE=3 SV=1 | 15 | 406 | 3.0E-71 |
| sp|Q92LB2|PROA_RHIME | Gamma-glutamyl phosphate reductase OS=Rhizobium meliloti (strain 1021) GN=proA PE=3 SV=1 | 5 | 406 | 3.0E-71 |
| sp|A9LYY9|PROA_NEIM0 | Gamma-glutamyl phosphate reductase OS=Neisseria meningitidis serogroup C (strain 053442) GN=proA PE=3 SV=1 | 13 | 406 | 4.0E-71 |
| sp|A9KMV0|PROA_CLOPH | Gamma-glutamyl phosphate reductase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=proA PE=3 SV=1 | 11 | 406 | 4.0E-71 |
| sp|A7Z3T1|PROA_BACMF | Gamma-glutamyl phosphate reductase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=proA PE=3 SV=1 | 26 | 406 | 4.0E-71 |
| sp|B4SG68|PROA_PELPB | Gamma-glutamyl phosphate reductase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=proA PE=3 SV=1 | 14 | 406 | 4.0E-71 |
| sp|B8DHP3|PROA_LISMH | Gamma-glutamyl phosphate reductase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=proA PE=3 SV=1 | 13 | 406 | 4.0E-71 |
| sp|Q8A1E8|PROA_BACTN | Gamma-glutamyl phosphate reductase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=proA PE=3 SV=1 | 13 | 418 | 5.0E-71 |
| sp|Q87EK9|PROA_XYLFT | Gamma-glutamyl phosphate reductase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=proA PE=3 SV=1 | 80 | 406 | 5.0E-71 |
| sp|B2I7L2|PROA_XYLF2 | Gamma-glutamyl phosphate reductase OS=Xylella fastidiosa (strain M23) GN=proA PE=3 SV=1 | 80 | 406 | 5.0E-71 |
| sp|B8IEM1|PROA_METNO | Gamma-glutamyl phosphate reductase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=proA PE=3 SV=1 | 41 | 406 | 5.0E-71 |
| sp|A4J3Q0|PROA_DESRM | Gamma-glutamyl phosphate reductase OS=Desulfotomaculum reducens (strain MI-1) GN=proA PE=3 SV=1 | 7 | 406 | 5.0E-71 |
| sp|A9WWW7|PROA_BRUSI | Gamma-glutamyl phosphate reductase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=proA PE=3 SV=1 | 3 | 406 | 5.0E-71 |
| sp|Q9PEM3|PROA_XYLFA | Gamma-glutamyl phosphate reductase OS=Xylella fastidiosa (strain 9a5c) GN=proA PE=3 SV=2 | 80 | 406 | 7.0E-71 |
| sp|A1SHP5|PROA_NOCSJ | Gamma-glutamyl phosphate reductase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=proA PE=3 SV=1 | 19 | 404 | 7.0E-71 |
| sp|Q03ZF1|PROA_LEUMM | Gamma-glutamyl phosphate reductase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=proA PE=3 SV=1 | 6 | 406 | 7.0E-71 |
| sp|B3EPD4|PROA_CHLPB | Gamma-glutamyl phosphate reductase OS=Chlorobium phaeobacteroides (strain BS1) GN=proA PE=3 SV=1 | 16 | 409 | 8.0E-71 |
| sp|A9IMB2|PROA_BART1 | Gamma-glutamyl phosphate reductase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=proA PE=3 SV=2 | 30 | 409 | 9.0E-71 |
| sp|Q1IZP1|PROA_DEIGD | Gamma-glutamyl phosphate reductase OS=Deinococcus geothermalis (strain DSM 11300) GN=proA PE=3 SV=2 | 80 | 406 | 9.0E-71 |
| sp|C1L2G7|PROA_LISMC | Gamma-glutamyl phosphate reductase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=proA PE=3 SV=1 | 13 | 406 | 1.0E-70 |
| sp|A8M064|PROA_SALAI | Gamma-glutamyl phosphate reductase OS=Salinispora arenicola (strain CNS-205) GN=proA PE=3 SV=1 | 22 | 406 | 1.0E-70 |
| sp|Q81P27|PROA_BACAN | Gamma-glutamyl phosphate reductase OS=Bacillus anthracis GN=proA PE=3 SV=1 | 15 | 406 | 1.0E-70 |
| sp|C3LEW9|PROA_BACAC | Gamma-glutamyl phosphate reductase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=proA PE=3 SV=1 | 15 | 406 | 1.0E-70 |
| sp|C3NZU4|PROA_BACAA | Gamma-glutamyl phosphate reductase OS=Bacillus anthracis (strain A0248) GN=proA PE=3 SV=1 | 15 | 406 | 1.0E-70 |
| sp|Q720G3|PROA_LISMF | Gamma-glutamyl phosphate reductase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=proA PE=3 SV=1 | 13 | 406 | 1.0E-70 |
| sp|Q9KCR5|PROA_BACHD | Gamma-glutamyl phosphate reductase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=proA PE=3 SV=1 | 10 | 406 | 3.0E-70 |
| sp|P32296|P5CS_VIGAC | Delta-1-pyrroline-5-carboxylate synthase OS=Vigna aconitifolia PE=2 SV=1 | 34 | 370 | 4.0E-70 |
| sp|Q7NEF6|PROA_GLOVI | Gamma-glutamyl phosphate reductase OS=Gloeobacter violaceus (strain PCC 7421) GN=proA PE=3 SV=1 | 12 | 406 | 4.0E-70 |
| sp|Q2IMG0|PROA_ANADE | Gamma-glutamyl phosphate reductase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=proA PE=3 SV=1 | 80 | 404 | 4.0E-70 |
| sp|A1AVH0|PROA_RUTMC | Gamma-glutamyl phosphate reductase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=proA PE=3 SV=1 | 15 | 404 | 8.0E-70 |
| sp|Q9RDK1|PROA_STRCO | Gamma-glutamyl phosphate reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=proA PE=3 SV=3 | 22 | 404 | 1.0E-69 |
| sp|A1S8L1|PROA_SHEAM | Gamma-glutamyl phosphate reductase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=proA PE=3 SV=1 | 10 | 405 | 2.0E-69 |
| sp|B3EE24|PROA_CHLL2 | Gamma-glutamyl phosphate reductase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=proA PE=3 SV=1 | 14 | 406 | 3.0E-69 |
| sp|Q0AWJ6|PROA_SYNWW | Gamma-glutamyl phosphate reductase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=proA PE=3 SV=1 | 10 | 406 | 7.0E-69 |
| sp|A5FYS4|PROA_ACICJ | Gamma-glutamyl phosphate reductase OS=Acidiphilium cryptum (strain JF-5) GN=proA PE=3 SV=1 | 21 | 406 | 1.0E-68 |
| sp|Q8DVM9|PROA_STRMU | Gamma-glutamyl phosphate reductase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=proA PE=3 SV=1 | 9 | 406 | 2.0E-68 |
| sp|P0DD21|PROA_STRPQ | Gamma-glutamyl phosphate reductase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=proA PE=3 SV=1 | 15 | 404 | 2.0E-68 |
| sp|P0DD20|PROA_STRP3 | Gamma-glutamyl phosphate reductase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=proA PE=3 SV=1 | 15 | 404 | 2.0E-68 |
| sp|O86053|PROA_MEIRU | Gamma-glutamyl phosphate reductase OS=Meiothermus ruber GN=proA PE=3 SV=1 | 22 | 406 | 2.0E-68 |
| sp|Q3IEY7|PROA_PSEHT | Gamma-glutamyl phosphate reductase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=proA PE=3 SV=1 | 10 | 406 | 2.0E-68 |
| sp|C0QLF1|PROA_DESAH | Gamma-glutamyl phosphate reductase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=proA PE=3 SV=1 | 9 | 406 | 2.0E-68 |
| sp|B3QPW0|PROA_CHLP8 | Gamma-glutamyl phosphate reductase OS=Chlorobaculum parvum (strain NCIB 8327) GN=proA PE=3 SV=1 | 14 | 406 | 2.0E-68 |
| sp|C4XSQ4|PROA_DESMR | Gamma-glutamyl phosphate reductase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=proA PE=3 SV=1 | 41 | 406 | 4.0E-68 |
| sp|A5CXP4|PROA_VESOH | Gamma-glutamyl phosphate reductase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=proA PE=3 SV=1 | 15 | 404 | 4.0E-68 |
| sp|Q48RY7|PROA_STRPM | Gamma-glutamyl phosphate reductase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=proA PE=3 SV=1 | 15 | 404 | 4.0E-68 |
| sp|A2RD38|PROA_STRPG | Gamma-glutamyl phosphate reductase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=proA PE=3 SV=1 | 15 | 404 | 4.0E-68 |
| sp|Q1JAG3|PROA_STRPB | Gamma-glutamyl phosphate reductase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=proA PE=3 SV=1 | 15 | 404 | 4.0E-68 |
| sp|Q8NZX9|PROA_STRP8 | Gamma-glutamyl phosphate reductase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=proA PE=3 SV=1 | 15 | 404 | 4.0E-68 |
| sp|Q5XAL0|PROA_STRP6 | Gamma-glutamyl phosphate reductase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=proA PE=3 SV=1 | 15 | 404 | 4.0E-68 |
| sp|Q9RTD9|PROA_DEIRA | Gamma-glutamyl phosphate reductase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=proA PE=3 SV=1 | 22 | 406 | 4.0E-68 |
| sp|Q3ARL1|PROA_CHLCH | Gamma-glutamyl phosphate reductase OS=Chlorobium chlorochromatii (strain CaD3) GN=proA PE=3 SV=1 | 17 | 406 | 5.0E-68 |
| sp|Q8KCE9|PROA_CHLTE | Gamma-glutamyl phosphate reductase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=proA PE=3 SV=1 | 14 | 406 | 5.0E-68 |
| sp|A1BAM3|PROA_PARDP | Gamma-glutamyl phosphate reductase OS=Paracoccus denitrificans (strain Pd 1222) GN=proA PE=3 SV=1 | 30 | 404 | 5.0E-68 |
| sp|B5XML5|PROA_STRPZ | Gamma-glutamyl phosphate reductase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=proA PE=3 SV=1 | 15 | 404 | 7.0E-68 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0016491 | oxidoreductase activity | Yes |
| GO:0003674 | molecular_function | No |
| GO:0003824 | catalytic activity | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 24 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Ophun1|1033 MSLTNGSAEEIAAAARRASTTLAALSAADRDAALEAVYSALEAAREDILAANARDVQAAAGADPALVARLDLSRG GKWEVGRVQARTKLDDGLVLERVSCPIGVILVIFEARPEVIANIASLALKSGNAAILKGGKESTESFIAISHAIS SALKASSVVPPAAIQLVTTREDVGRLLAQERDIDLVIPRGSNQLVRNIKLGTRIPVLGHADGLCAVYLTDSADAE KAAALMVDAKTSYPAACNSVETLLVQESAVQTIFPIVAKALIEHGVTLLCDPPTLTSALSIAQDATLIQQATAND YTTEFLSKTLAVKTIPSLDEAIAHINAHGSHHTDAILTASAPDAERFMQRVDSAGVFWNASTRVADGTRYGFGTE VGISTNKIHARGPVGLEGLTIYKYKVRGDYQPTAEYGSGKRRWKHEALPL* |
| Coding | >Ophun1|1033 ATGTCGCTTACCAACGGTTCGGCAGAGGAAATAGCCGCCGCTGCTCGACGTGCTTCTACCACGTTGGCTGCCCTC TCAGCCGCGGACCGCGACGCCGCTCTCGAGGCCGTGTATTCTGCGCTGGAGGCTGCGCGGGAGGACATTCTCGCT GCGAATGCGAGGGATGTGCAGGCTGCGGCTGGGGCGGATCCTGCTCTCGTTGCCAGGTTGGATCTCTCCAGGGGG GGGAAGTGGGAGGTTGGGAGGGTGCAGGCGCGGACGAAACTTGATGATGGCCTCGTTCTCGAGAGGGTGAGCTGT CCGATAGGCGTCATCCTCGTCATCTTCGAAGCCCGCCCCGAAGTCATCGCAAACATCGCCTCCCTAGCCCTCAAA TCCGGCAACGCCGCCATCCTAAAAGGCGGCAAAGAATCCACCGAATCCTTCATCGCCATCTCCCACGCCATCTCC TCCGCCCTCAAAGCCTCGTCCGTTGTGCCCCCCGCCGCCATCCAGCTCGTCACCACGCGCGAGGATGTTGGACGG TTGCTTGCGCAGGAGCGGGATATCGATCTCGTCATTCCCAGGGGTTCCAACCAGCTTGTTCGGAATATCAAGCTG GGCACTAGGATCCCTGTCCTGGGTCATGCCGATGGGCTTTGCGCCGTCTATCTTACCGATAGTGCCGATGCGGAA AAGGCTGCTGCTCTCATGGTCGACGCCAAGACGAGCTACCCAGCCGCCTGCAACAGCGTGGAAACCCTCCTCGTG CAGGAATCAGCAGTGCAAACAATCTTCCCCATCGTGGCCAAAGCCCTGATCGAACACGGCGTCACCCTCCTCTGC GACCCGCCCACCCTCACCTCGGCCCTCTCCATCGCCCAAGACGCAACGCTCATCCAACAAGCCACGGCAAACGAC TACACAACAGAATTCCTCTCCAAGACGCTGGCCGTCAAGACAATCCCCTCTCTCGACGAAGCAATAGCCCACATC AACGCCCACGGCTCCCACCACACAGACGCCATCCTCACCGCCTCGGCCCCCGACGCCGAACGCTTCATGCAGCGC GTTGACTCGGCCGGCGTCTTCTGGAATGCGTCTACGCGCGTTGCCGATGGGACGCGCTACGGCTTCGGCACAGAG GTCGGCATCAGCACTAATAAGATTCATGCCCGGGGGCCTGTCGGTCTCGAGGGCCTCACTATTTACAAGTACAAG GTTCGCGGCGATTATCAACCTACGGCTGAGTATGGGTCGGGCAAGCGGAGGTGGAAGCATGAGGCGCTGCCTTTG TGA |
| Transcript | >Ophun1|1033 ATGTCGCTTACCAACGGTTCGGCAGAGGAAATAGCCGCCGCTGCTCGACGTGCTTCTACCACGTTGGCTGCCCTC TCAGCCGCGGACCGCGACGCCGCTCTCGAGGCCGTGTATTCTGCGCTGGAGGCTGCGCGGGAGGACATTCTCGCT GCGAATGCGAGGGATGTGCAGGCTGCGGCTGGGGCGGATCCTGCTCTCGTTGCCAGGTTGGATCTCTCCAGGGGG GGGAAGTGGGAGGTTGGGAGGGTGCAGGCGCGGACGAAACTTGATGATGGCCTCGTTCTCGAGAGGGTGAGCTGT CCGATAGGCGTCATCCTCGTCATCTTCGAAGCCCGCCCCGAAGTCATCGCAAACATCGCCTCCCTAGCCCTCAAA TCCGGCAACGCCGCCATCCTAAAAGGCGGCAAAGAATCCACCGAATCCTTCATCGCCATCTCCCACGCCATCTCC TCCGCCCTCAAAGCCTCGTCCGTTGTGCCCCCCGCCGCCATCCAGCTCGTCACCACGCGCGAGGATGTTGGACGG TTGCTTGCGCAGGAGCGGGATATCGATCTCGTCATTCCCAGGGGTTCCAACCAGCTTGTTCGGAATATCAAGCTG GGCACTAGGATCCCTGTCCTGGGTCATGCCGATGGGCTTTGCGCCGTCTATCTTACCGATAGTGCCGATGCGGAA AAGGCTGCTGCTCTCATGGTCGACGCCAAGACGAGCTACCCAGCCGCCTGCAACAGCGTGGAAACCCTCCTCGTG CAGGAATCAGCAGTGCAAACAATCTTCCCCATCGTGGCCAAAGCCCTGATCGAACACGGCGTCACCCTCCTCTGC GACCCGCCCACCCTCACCTCGGCCCTCTCCATCGCCCAAGACGCAACGCTCATCCAACAAGCCACGGCAAACGAC TACACAACAGAATTCCTCTCCAAGACGCTGGCCGTCAAGACAATCCCCTCTCTCGACGAAGCAATAGCCCACATC AACGCCCACGGCTCCCACCACACAGACGCCATCCTCACCGCCTCGGCCCCCGACGCCGAACGCTTCATGCAGCGC GTTGACTCGGCCGGCGTCTTCTGGAATGCGTCTACGCGCGTTGCCGATGGGACGCGCTACGGCTTCGGCACAGAG GTCGGCATCAGCACTAATAAGATTCATGCCCGGGGGCCTGTCGGTCTCGAGGGCCTCACTATTTACAAGTACAAG GTTCGCGGCGATTATCAACCTACGGCTGAGTATGGGTCGGGCAAGCGGAGGTGGAAGCATGAGGCGCTGCCTTTG TGA |
| Gene | >Ophun1|1033 ATGTCGCTTACCAACGGTTCGGCAGAGGAAATAGCCGCCGCTGCTCGACGTGCTTCTACCACGTTGGCTGCCCTC TCAGCCGCGGACCGCGACGCCGCTCTCGAGGCCGTGTATTCTGCGCTGGAGGCTGCGCGGGAGGACATTCTCGCT GCGAATGCGAGGGATGTGCAGGCTGCGGCTGGGGCGGATCCTGCTCTCGTTGCCAGGTTGGATCTCTCCAGGGGG GGGAAGTGGGAGGGTATGGTGGAGGGGGTGATGGATGTGAGGCGGTTGGGAGATCCCAGTGAGTTTGTTCTTCTT CCTTCTTCTTTCTTTGGAGCTGGCTGATGAGGGTAGTTGGGAGGGTGCAGGCGCGGACGAAACTTGATGATGGCC TCGTTCTCGAGAGGGTGAGCTGTCCGATAGGCGTCATCCTCGTCATCTTCGAAGCCCGCCCCGAAGTCATCGCAA ACATCGCCTCCCTAGCCCTCAAATCCGGCAACGCCGCCATCCTAAAAGGCGGCAAAGAATCCACCGAATCCTTCA TCGCCATCTCCCACGCCATCTCCTCCGCCCTCAAAGCCTCGTCCGTTGTGCCCCCCGCCGCCATCCAGCTCGTCA CCACGCGCGAGGATGTTGGACGGTTGCTTGCGCAGGAGCGGGATATCGATCTCGTCATTCCCAGGGGTTCCAACC AGCTTGTTCGGAATATCAAGCTGGGCACTAGGATCCCTGTCCTGGGTCATGCCGATGGGCTTTGCGCCGTCTATC TTACCGATAGTGCCGATGCGGAAAAGGCTGCTGCTCTCATGGTCGACGCCAAGACGAGCTACCCAGCCGCCTGCA ACAGCGTGGAAACCCTCCTCGTGCAGGAATCAGCAGTGCAAACAATCTTCCCCATCGTGGCCAAAGCCCTGATCG AACACGGCGTCACCCTCCTCTGCGACCCGCCCACCCTCACCTCGGCCCTCTCCATCGCCCAAGACGCAACGCTCA TCCAACAAGCCACGGCAAACGACTACACAACAGAATTCCTCTCCAAGACGCTGGCCGTCAAGACAATCCCCTCTC TCGACGAAGCAATAGCCCACATCAACGCCCACGGCTCCCACCACACAGACGCCATCCTCACCGCCTCGGCCCCCG ACGCCGAACGCTTCATGCAGCGCGTTGACTCGGCCGGCGTCTTCTGGAATGCGTCTACGCGCGTTGCCGATGGGA CGCGCTACGGCTTCGGCACAGAGGTCGGCATCAGCACTAATAAGATTCATGCCCGGGGGCCTGTCGGTCTCGAGG GCCTCACTATTTACAAGTACAAGGTTCGCGGCGATTATCAACCTACGGCTGAGTATGGGTCGGGCAAGCGGAGGT GGAAGCATGAGGCGCTGCCTTTGTGA |