Protein ID | Ophun1|1031 |
Gene name | |
Location | Contig_139:18481..21091 |
Strand | + |
Gene length (bp) | 2610 |
Transcript length (bp) | 1776 |
Coding sequence length (bp) | 1776 |
Protein length (aa) | 592 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF07991 | IlvN | Acetohydroxy acid isomeroreductase, NADPH-binding domain | 3.2E-44 | 263 | 427 |
PF01450 | IlvC | Acetohydroxy acid isomeroreductase, catalytic domain | 9.8E-40 | 435 | 579 |
PF00179 | UQ_con | Ubiquitin-conjugating enzyme | 1.6E-36 | 35 | 168 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P38674|ILV5_NEUCR | Ketol-acid reductoisomerase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ilv-2 PE=3 SV=2 | 187 | 582 | 0.0E+00 |
sp|P78827|ILV5_SCHPO | Probable ketol-acid reductoisomerase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ilv5 PE=1 SV=2 | 189 | 581 | 0.0E+00 |
sp|P06168|ILV5_YEAST | Ketol-acid reductoisomerase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV5 PE=1 SV=1 | 191 | 582 | 0.0E+00 |
sp|Q6C9W0|UBC12_YARLI | NEDD8-conjugating enzyme UBC12 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=UBC12 PE=3 SV=1 | 1 | 186 | 2.0E-86 |
sp|Q9VSF3|UBC12_DROME | Nedd8-conjugating enzyme Ubc12 OS=Drosophila melanogaster GN=Ubc12 PE=1 SV=1 | 1 | 186 | 7.0E-72 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P38674|ILV5_NEUCR | Ketol-acid reductoisomerase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ilv-2 PE=3 SV=2 | 187 | 582 | 0.0E+00 |
sp|P78827|ILV5_SCHPO | Probable ketol-acid reductoisomerase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ilv5 PE=1 SV=2 | 189 | 581 | 0.0E+00 |
sp|P06168|ILV5_YEAST | Ketol-acid reductoisomerase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV5 PE=1 SV=1 | 191 | 582 | 0.0E+00 |
sp|Q6C9W0|UBC12_YARLI | NEDD8-conjugating enzyme UBC12 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=UBC12 PE=3 SV=1 | 1 | 186 | 2.0E-86 |
sp|Q9VSF3|UBC12_DROME | Nedd8-conjugating enzyme Ubc12 OS=Drosophila melanogaster GN=Ubc12 PE=1 SV=1 | 1 | 186 | 7.0E-72 |
sp|Q6DCZ9|UBC12_XENLA | NEDD8-conjugating enzyme Ubc12 OS=Xenopus laevis GN=ube2m PE=2 SV=1 | 1 | 184 | 8.0E-72 |
sp|Q6P8D9|UBC12_XENTR | NEDD8-conjugating enzyme Ubc12 OS=Xenopus tropicalis GN=ube2m PE=2 SV=1 | 1 | 184 | 1.0E-71 |
sp|P61082|UBC12_MOUSE | NEDD8-conjugating enzyme Ubc12 OS=Mus musculus GN=Ube2m PE=1 SV=1 | 1 | 184 | 2.0E-70 |
sp|P61081|UBC12_HUMAN | NEDD8-conjugating enzyme Ubc12 OS=Homo sapiens GN=UBE2M PE=1 SV=1 | 1 | 184 | 2.0E-70 |
sp|A3KN22|UBC12_BOVIN | NEDD8-conjugating enzyme Ubc12 OS=Bos taurus GN=UBE2M PE=2 SV=1 | 1 | 184 | 2.0E-70 |
sp|O74549|UBC12_SCHPO | NEDD8-conjugating enzyme ubc12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc12 PE=3 SV=1 | 1 | 184 | 1.0E-65 |
sp|Q9ZU75|UB12L_ARATH | Probable NEDD8-conjugating enzyme Ubc12-like OS=Arabidopsis thaliana GN=RCE2 PE=2 SV=1 | 3 | 184 | 9.0E-59 |
sp|Q9SDY5|RCE1_ARATH | NEDD8-conjugating enzyme Ubc12 OS=Arabidopsis thaliana GN=RCE1 PE=1 SV=1 | 4 | 184 | 3.0E-58 |
sp|Q54TI6|UBC12_DICDI | NEDD8-conjugating enzyme Ubc12 OS=Dictyostelium discoideum GN=ube2m PE=3 SV=1 | 20 | 184 | 6.0E-50 |
sp|Q2FM37|ILVC_METHJ | Ketol-acid reductoisomerase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=ilvC PE=3 SV=1 | 266 | 517 | 1.0E-48 |
sp|O82043|ILV5_PEA | Ketol-acid reductoisomerase, chloroplastic OS=Pisum sativum GN=PGAAIR PE=2 SV=1 | 188 | 579 | 1.0E-48 |
sp|Q65XK0|ILV5_ORYSJ | Ketol-acid reductoisomerase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os05g0573700 PE=1 SV=1 | 235 | 581 | 1.0E-48 |
sp|Q8U2A3|ILVC_PYRFU | Ketol-acid reductoisomerase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=ilvC PE=3 SV=1 | 247 | 517 | 2.0E-48 |
sp|Q2JXL2|ILVC_SYNJA | Ketol-acid reductoisomerase OS=Synechococcus sp. (strain JA-3-3Ab) GN=ilvC PE=3 SV=1 | 259 | 515 | 1.0E-47 |
sp|Q9UZ09|ILVC_PYRAB | Ketol-acid reductoisomerase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=ilvC PE=3 SV=1 | 259 | 577 | 1.0E-47 |
sp|Q9UWX9|ILVC1_SULSO | Ketol-acid reductoisomerase 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=ilvC1 PE=3 SV=1 | 259 | 512 | 2.0E-47 |
sp|B2URB8|ILVC_AKKM8 | Ketol-acid reductoisomerase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=ilvC PE=3 SV=1 | 259 | 510 | 3.0E-47 |
sp|A9A7D0|ILVC_METM6 | Ketol-acid reductoisomerase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=ilvC PE=3 SV=1 | 247 | 577 | 4.0E-47 |
sp|A4WLK6|ILVC_PYRAR | Ketol-acid reductoisomerase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=ilvC PE=3 SV=1 | 255 | 577 | 4.0E-47 |
sp|A4FYE4|ILVC_METM5 | Ketol-acid reductoisomerase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=ilvC PE=3 SV=1 | 247 | 577 | 6.0E-47 |
sp|B0SL33|ILVC_LEPBP | Ketol-acid reductoisomerase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=ilvC PE=3 SV=1 | 259 | 510 | 7.0E-47 |
sp|B0SCQ5|ILVC_LEPBA | Ketol-acid reductoisomerase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=ilvC PE=3 SV=1 | 259 | 510 | 7.0E-47 |
sp|A6VJW0|ILVC_METM7 | Ketol-acid reductoisomerase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=ilvC PE=3 SV=1 | 247 | 577 | 7.0E-47 |
sp|A6USF9|ILVC_METVS | Ketol-acid reductoisomerase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=ilvC PE=3 SV=1 | 259 | 577 | 1.0E-46 |
sp|A3MX05|ILVC_PYRCJ | Ketol-acid reductoisomerase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=ilvC PE=3 SV=1 | 259 | 577 | 1.0E-46 |
sp|Q58938|ILVC_METJA | Ketol-acid reductoisomerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ilvC PE=3 SV=3 | 266 | 531 | 1.0E-46 |
sp|A4XIL7|ILVC_CALS8 | Ketol-acid reductoisomerase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=ilvC PE=3 SV=1 | 259 | 579 | 2.0E-46 |
sp|Q05758|ILV5_ARATH | Ketol-acid reductoisomerase, chloroplastic OS=Arabidopsis thaliana GN=At3g58610 PE=2 SV=2 | 235 | 579 | 3.0E-46 |
sp|C3MW82|ILVC_SULIM | Ketol-acid reductoisomerase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=ilvC PE=3 SV=1 | 259 | 512 | 4.0E-46 |
sp|C4KHT9|ILVC_SULIK | Ketol-acid reductoisomerase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=ilvC PE=3 SV=1 | 259 | 512 | 4.0E-46 |
sp|C3N6C4|ILVC_SULIA | Ketol-acid reductoisomerase OS=Sulfolobus islandicus (strain M.16.27) GN=ilvC PE=3 SV=1 | 259 | 512 | 4.0E-46 |
sp|C3NET2|ILVC_SULIY | Ketol-acid reductoisomerase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=ilvC PE=3 SV=1 | 259 | 512 | 4.0E-46 |
sp|B9MNV1|ILVC_CALBD | Ketol-acid reductoisomerase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=ilvC PE=3 SV=1 | 259 | 579 | 5.0E-46 |
sp|A0RXE1|ILVC_CENSY | Ketol-acid reductoisomerase OS=Cenarchaeum symbiosum (strain A) GN=ilvC PE=3 SV=1 | 247 | 577 | 6.0E-46 |
sp|Q6LZH4|ILVC_METMP | Ketol-acid reductoisomerase OS=Methanococcus maripaludis (strain S2 / LL) GN=ilvC PE=3 SV=1 | 247 | 577 | 6.0E-46 |
sp|C3NGW2|ILVC_SULIN | Ketol-acid reductoisomerase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=ilvC PE=3 SV=1 | 259 | 512 | 7.0E-46 |
sp|C3MQK4|ILVC_SULIL | Ketol-acid reductoisomerase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=ilvC PE=3 SV=1 | 259 | 512 | 9.0E-46 |
sp|A4IRH9|ILVC_GEOTN | Ketol-acid reductoisomerase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=ilvC PE=3 SV=1 | 260 | 517 | 1.0E-45 |
sp|Q5KWJ2|ILVC_GEOKA | Ketol-acid reductoisomerase OS=Geobacillus kaustophilus (strain HTA426) GN=ilvC PE=3 SV=1 | 260 | 587 | 1.0E-45 |
sp|Q8EN66|ILVC_OCEIH | Ketol-acid reductoisomerase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ilvC PE=3 SV=1 | 262 | 510 | 2.0E-45 |
sp|C0QTD8|ILVC_PERMH | Ketol-acid reductoisomerase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=ilvC PE=3 SV=1 | 259 | 584 | 2.0E-45 |
sp|Q30ZD3|ILVC_DESAG | Ketol-acid reductoisomerase OS=Desulfovibrio alaskensis (strain G20) GN=ilvC PE=3 SV=1 | 259 | 510 | 2.0E-45 |
sp|B1Y9N6|ILVC_PYRNV | Ketol-acid reductoisomerase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=ilvC PE=3 SV=1 | 259 | 518 | 2.0E-45 |
sp|Q8TX44|ILVC_METKA | Ketol-acid reductoisomerase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=ilvC PE=3 SV=1 | 259 | 577 | 3.0E-45 |
sp|A9BGP6|ILVC_PETMO | Ketol-acid reductoisomerase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ilvC PE=3 SV=1 | 259 | 518 | 4.0E-45 |
sp|Q8ZTE1|ILVC_PYRAE | Ketol-acid reductoisomerase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=ilvC PE=3 SV=1 | 256 | 517 | 4.0E-45 |
sp|Q7NH80|ILVC_GLOVI | Ketol-acid reductoisomerase OS=Gloeobacter violaceus (strain PCC 7421) GN=ilvC PE=3 SV=1 | 266 | 568 | 4.0E-45 |
sp|A2SR20|ILVC_METLZ | Ketol-acid reductoisomerase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=ilvC PE=3 SV=1 | 259 | 533 | 6.0E-45 |
sp|O67289|ILVC_AQUAE | Ketol-acid reductoisomerase OS=Aquifex aeolicus (strain VF5) GN=ilvC PE=3 SV=1 | 259 | 579 | 6.0E-45 |
sp|Q31MY7|ILVC_SYNE7 | Ketol-acid reductoisomerase OS=Synechococcus elongatus (strain PCC 7942) GN=ilvC PE=3 SV=2 | 250 | 518 | 7.0E-45 |
sp|A4J179|ILVC_DESRM | Ketol-acid reductoisomerase OS=Desulfotomaculum reducens (strain MI-1) GN=ilvC PE=3 SV=1 | 259 | 518 | 8.0E-45 |
sp|Q5N667|ILVC_SYNP6 | Ketol-acid reductoisomerase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=ilvC PE=3 SV=1 | 250 | 518 | 9.0E-45 |
sp|B1HR99|ILVC_LYSSC | Ketol-acid reductoisomerase OS=Lysinibacillus sphaericus (strain C3-41) GN=ilvC PE=3 SV=1 | 260 | 579 | 1.0E-44 |
sp|A5IJM5|ILVC_THEP1 | Ketol-acid reductoisomerase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=ilvC PE=3 SV=1 | 259 | 510 | 1.0E-44 |
sp|B1WNP1|ILVC_CYAA5 | Ketol-acid reductoisomerase OS=Cyanothece sp. (strain ATCC 51142) GN=ilvC PE=3 SV=1 | 250 | 518 | 1.0E-44 |
sp|Q8DW43|ILVC_STRMU | Ketol-acid reductoisomerase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=ilvC PE=3 SV=1 | 264 | 517 | 2.0E-44 |
sp|C5D5M1|ILVC_GEOSW | Ketol-acid reductoisomerase OS=Geobacillus sp. (strain WCH70) GN=ilvC PE=3 SV=1 | 260 | 518 | 2.0E-44 |
sp|B2V7F0|ILVC_SULSY | Ketol-acid reductoisomerase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=ilvC PE=3 SV=1 | 259 | 574 | 2.0E-44 |
sp|A0AK91|ILVC_LISW6 | Ketol-acid reductoisomerase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=ilvC PE=3 SV=1 | 262 | 585 | 3.0E-44 |
sp|Q97MV0|ILVC_CLOAB | Ketol-acid reductoisomerase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=ilvC PE=3 SV=1 | 259 | 510 | 4.0E-44 |
sp|A1RRZ8|ILVC_PYRIL | Ketol-acid reductoisomerase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=ilvC PE=3 SV=1 | 259 | 518 | 4.0E-44 |
sp|B9KB98|ILVC_THENN | Ketol-acid reductoisomerase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=ilvC PE=3 SV=1 | 259 | 510 | 5.0E-44 |
sp|Q8Y5S0|ILVC_LISMO | Ketol-acid reductoisomerase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=ilvC PE=3 SV=1 | 262 | 585 | 5.0E-44 |
sp|B8DNQ9|ILVC_DESVM | Ketol-acid reductoisomerase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=ilvC PE=3 SV=1 | 259 | 510 | 1.0E-43 |
sp|Q81G13|ILVC1_BACCR | Ketol-acid reductoisomerase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ilvC1 PE=3 SV=2 | 247 | 579 | 1.0E-43 |
sp|B7KF23|ILVC_CYAP7 | Ketol-acid reductoisomerase OS=Cyanothece sp. (strain PCC 7424) GN=ilvC PE=3 SV=1 | 259 | 515 | 1.0E-43 |
sp|B8DBU5|ILVC_LISMH | Ketol-acid reductoisomerase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=ilvC PE=3 SV=1 | 262 | 585 | 2.0E-43 |
sp|Q71Y36|ILVC_LISMF | Ketol-acid reductoisomerase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=ilvC PE=3 SV=1 | 262 | 585 | 2.0E-43 |
sp|C1KWT0|ILVC_LISMC | Ketol-acid reductoisomerase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=ilvC PE=3 SV=1 | 262 | 585 | 2.0E-43 |
sp|Q92A29|ILVC_LISIN | Ketol-acid reductoisomerase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=ilvC PE=3 SV=1 | 262 | 585 | 2.0E-43 |
sp|Q49Z11|ILVC_STAS1 | Ketol-acid reductoisomerase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ilvC PE=3 SV=1 | 252 | 588 | 2.0E-43 |
sp|A9BBT2|ILVC_PROM4 | Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain MIT 9211) GN=ilvC PE=3 SV=1 | 259 | 577 | 2.0E-43 |
sp|P52491|UBC12_YEAST | NEDD8-conjugating enzyme UBC12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC12 PE=1 SV=1 | 8 | 184 | 2.0E-43 |
sp|Q6HLF4|ILVC1_BACHK | Ketol-acid reductoisomerase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ilvC1 PE=3 SV=1 | 247 | 579 | 2.0E-43 |
sp|Q63DX9|ILVC1_BACCZ | Ketol-acid reductoisomerase 1 OS=Bacillus cereus (strain ZK / E33L) GN=ilvC1 PE=3 SV=1 | 247 | 579 | 2.0E-43 |
sp|Q73BA1|ILVC1_BACC1 | Ketol-acid reductoisomerase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ilvC1 PE=3 SV=1 | 247 | 579 | 3.0E-43 |
sp|A3CXJ5|ILVC_METMJ | Ketol-acid reductoisomerase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=ilvC PE=3 SV=1 | 266 | 517 | 4.0E-43 |
sp|Q8TJJ4|ILVC_METAC | Ketol-acid reductoisomerase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=ilvC PE=3 SV=1 | 256 | 518 | 4.0E-43 |
sp|A7I5I8|ILVC_METB6 | Ketol-acid reductoisomerase OS=Methanoregula boonei (strain 6A8) GN=ilvC PE=3 SV=1 | 259 | 517 | 5.0E-43 |
sp|B1L8U5|ILVC_THESQ | Ketol-acid reductoisomerase OS=Thermotoga sp. (strain RQ2) GN=ilvC PE=3 SV=1 | 259 | 510 | 5.0E-43 |
sp|Q9WZ20|ILVC_THEMA | Ketol-acid reductoisomerase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ilvC PE=3 SV=1 | 259 | 510 | 5.0E-43 |
sp|Q01292|ILV5_SPIOL | Ketol-acid reductoisomerase, chloroplastic OS=Spinacia oleracea GN=AHRI PE=1 SV=1 | 258 | 579 | 5.0E-43 |
sp|A0RQ02|ILVC_CAMFF | Ketol-acid reductoisomerase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=ilvC PE=3 SV=1 | 259 | 510 | 5.0E-43 |
sp|A7I0D4|ILVC_CAMHC | Ketol-acid reductoisomerase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=ilvC PE=3 SV=1 | 259 | 579 | 6.0E-43 |
sp|Q7M851|ILVC_WOLSU | Ketol-acid reductoisomerase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=ilvC PE=3 SV=1 | 259 | 579 | 6.0E-43 |
sp|B8GIC5|ILVC_METPE | Ketol-acid reductoisomerase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=ilvC PE=3 SV=1 | 259 | 517 | 7.0E-43 |
sp|B5YEF3|ILVC_DICT6 | Ketol-acid reductoisomerase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=ilvC PE=3 SV=1 | 255 | 579 | 8.0E-43 |
sp|Q3MGX7|ILVC_ANAVT | Ketol-acid reductoisomerase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ilvC PE=3 SV=1 | 259 | 515 | 9.0E-43 |
sp|Q8YUM5|ILVC_NOSS1 | Ketol-acid reductoisomerase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ilvC PE=3 SV=1 | 259 | 515 | 9.0E-43 |
sp|A9KQ65|ILVC_CLOPH | Ketol-acid reductoisomerase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=ilvC PE=3 SV=1 | 259 | 533 | 1.0E-42 |
sp|B0TCQ9|ILVC_HELMI | Ketol-acid reductoisomerase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=ilvC PE=3 SV=1 | 259 | 579 | 1.0E-42 |
sp|B8E2W8|ILVC_DICTD | Ketol-acid reductoisomerase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=ilvC PE=3 SV=1 | 259 | 529 | 1.0E-42 |
sp|A1VYZ2|ILVC_CAMJJ | Ketol-acid reductoisomerase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=ilvC PE=3 SV=1 | 259 | 579 | 2.0E-42 |
sp|Q6FVQ8|UBC12_CANGA | NEDD8-conjugating enzyme UBC12 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=UBC12 PE=3 SV=1 | 14 | 184 | 2.0E-42 |
sp|P37253|ILVC_BACSU | Ketol-acid reductoisomerase OS=Bacillus subtilis (strain 168) GN=ilvC PE=1 SV=1 | 264 | 579 | 2.0E-42 |
sp|C0R090|ILVC_BRAHW | Ketol-acid reductoisomerase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=ilvC PE=3 SV=1 | 264 | 568 | 2.0E-42 |
sp|A7GXQ8|ILVC_CAMC5 | Ketol-acid reductoisomerase OS=Campylobacter curvus (strain 525.92) GN=ilvC PE=3 SV=1 | 259 | 510 | 2.0E-42 |
sp|Q5WEN2|ILVC_BACSK | Ketol-acid reductoisomerase OS=Bacillus clausii (strain KSM-K16) GN=ilvC PE=3 SV=1 | 256 | 579 | 3.0E-42 |
sp|A9A2E4|ILVC_NITMS | Ketol-acid reductoisomerase OS=Nitrosopumilus maritimus (strain SCM1) GN=ilvC PE=3 SV=1 | 247 | 577 | 3.0E-42 |
sp|Q8PZ26|ILVC_METMA | Ketol-acid reductoisomerase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=ilvC PE=3 SV=1 | 256 | 517 | 3.0E-42 |
sp|Q5HVD9|ILVC_CAMJR | Ketol-acid reductoisomerase OS=Campylobacter jejuni (strain RM1221) GN=ilvC PE=3 SV=1 | 259 | 579 | 3.0E-42 |
sp|Q0IC80|ILVC_SYNS3 | Ketol-acid reductoisomerase OS=Synechococcus sp. (strain CC9311) GN=ilvC PE=3 SV=1 | 259 | 521 | 3.0E-42 |
sp|A2CB87|ILVC_PROM3 | Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain MIT 9303) GN=ilvC PE=3 SV=1 | 259 | 577 | 4.0E-42 |
sp|B7GH18|ILVC_ANOFW | Ketol-acid reductoisomerase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=ilvC PE=3 SV=1 | 261 | 518 | 4.0E-42 |
sp|Q2JKN5|ILVC_SYNJB | Ketol-acid reductoisomerase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=ilvC PE=3 SV=1 | 259 | 515 | 4.0E-42 |
sp|C0Z9C7|ILVC_BREBN | Ketol-acid reductoisomerase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=ilvC PE=3 SV=1 | 260 | 510 | 5.0E-42 |
sp|Q81T69|ILVC1_BACAN | Ketol-acid reductoisomerase 1 OS=Bacillus anthracis GN=ilvC1 PE=3 SV=1 | 247 | 531 | 5.0E-42 |
sp|A8G6C6|ILVC_PROM2 | Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain MIT 9215) GN=ilvC PE=3 SV=1 | 259 | 510 | 6.0E-42 |
sp|Q02CM4|ILVC_SOLUE | Ketol-acid reductoisomerase OS=Solibacter usitatus (strain Ellin6076) GN=ilvC PE=3 SV=1 | 259 | 515 | 6.0E-42 |
sp|Q9K8E7|ILVC_BACHD | Ketol-acid reductoisomerase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ilvC PE=3 SV=1 | 262 | 521 | 6.0E-42 |
sp|A7Z7B9|ILVC_BACMF | Ketol-acid reductoisomerase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=ilvC PE=3 SV=1 | 264 | 521 | 8.0E-42 |
sp|Q7P0H9|ILVC_CHRVO | Ketol-acid reductoisomerase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ilvC PE=3 SV=1 | 259 | 510 | 8.0E-42 |
sp|A2BSN6|ILVC_PROMS | Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain AS9601) GN=ilvC PE=3 SV=1 | 259 | 510 | 8.0E-42 |
sp|A3PEE9|ILVC_PROM0 | Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain MIT 9301) GN=ilvC PE=3 SV=1 | 259 | 577 | 9.0E-42 |
sp|A8FL53|ILVC_CAMJ8 | Ketol-acid reductoisomerase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=ilvC PE=3 SV=1 | 259 | 579 | 1.0E-41 |
sp|B0JRP2|ILVC_MICAN | Ketol-acid reductoisomerase OS=Microcystis aeruginosa (strain NIES-843) GN=ilvC PE=3 SV=1 | 259 | 568 | 1.0E-41 |
sp|B9KCI3|ILVC_CAMLR | Ketol-acid reductoisomerase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=ilvC PE=3 SV=1 | 259 | 518 | 1.0E-41 |
sp|A7GMU0|ILVC_BACCN | Ketol-acid reductoisomerase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=ilvC PE=3 SV=1 | 258 | 531 | 1.0E-41 |
sp|A7H4H9|ILVC_CAMJD | Ketol-acid reductoisomerase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=ilvC PE=3 SV=1 | 259 | 579 | 1.0E-41 |
sp|A0L626|ILVC_MAGMM | Ketol-acid reductoisomerase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=ilvC PE=3 SV=1 | 267 | 529 | 1.0E-41 |
sp|Q8CRQ6|ILVC_STAES | Ketol-acid reductoisomerase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ilvC PE=3 SV=1 | 262 | 588 | 1.0E-41 |
sp|Q5HMG0|ILVC_STAEQ | Ketol-acid reductoisomerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ilvC PE=3 SV=1 | 262 | 588 | 1.0E-41 |
sp|Q9PHN5|ILVC_CAMJE | Ketol-acid reductoisomerase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=ilvC PE=1 SV=1 | 259 | 579 | 1.0E-41 |
sp|B0K0Y0|ILVC_THEPX | Ketol-acid reductoisomerase OS=Thermoanaerobacter sp. (strain X514) GN=ilvC PE=3 SV=1 | 259 | 510 | 2.0E-41 |
sp|A1VE41|ILVC_DESVV | Ketol-acid reductoisomerase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=ilvC PE=3 SV=1 | 259 | 510 | 2.0E-41 |
sp|Q72CA6|ILVC_DESVH | Ketol-acid reductoisomerase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=ilvC PE=3 SV=1 | 259 | 510 | 2.0E-41 |
sp|Q7V8M5|ILVC_PROMM | Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain MIT 9313) GN=ilvC PE=3 SV=1 | 259 | 577 | 2.0E-41 |
sp|A8FFW6|ILVC_BACP2 | Ketol-acid reductoisomerase OS=Bacillus pumilus (strain SAFR-032) GN=ilvC PE=3 SV=1 | 262 | 521 | 2.0E-41 |
sp|Q5SJ03|ILVC_THET8 | Ketol-acid reductoisomerase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=ilvC PE=3 SV=1 | 259 | 515 | 2.0E-41 |
sp|Q72JC8|ILVC_THET2 | Ketol-acid reductoisomerase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=ilvC PE=3 SV=1 | 259 | 515 | 2.0E-41 |
sp|Q3ALC5|ILVC_SYNSC | Ketol-acid reductoisomerase OS=Synechococcus sp. (strain CC9605) GN=ilvC PE=3 SV=1 | 259 | 521 | 2.0E-41 |
sp|C6BXE6|ILVC_DESAD | Ketol-acid reductoisomerase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=ilvC PE=3 SV=1 | 259 | 517 | 3.0E-41 |
sp|Q8P5L5|ILVC_XANCP | Ketol-acid reductoisomerase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ilvC PE=3 SV=1 | 266 | 582 | 4.0E-41 |
sp|B0RP32|ILVC_XANCB | Ketol-acid reductoisomerase OS=Xanthomonas campestris pv. campestris (strain B100) GN=ilvC PE=3 SV=1 | 266 | 582 | 4.0E-41 |
sp|Q4UYF7|ILVC_XANC8 | Ketol-acid reductoisomerase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ilvC PE=3 SV=1 | 266 | 582 | 4.0E-41 |
sp|C1DA41|ILVC_LARHH | Ketol-acid reductoisomerase OS=Laribacter hongkongensis (strain HLHK9) GN=ilvC PE=3 SV=1 | 259 | 510 | 4.0E-41 |
sp|B2J2U6|ILVC_NOSP7 | Ketol-acid reductoisomerase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=ilvC PE=3 SV=1 | 259 | 568 | 5.0E-41 |
sp|Q319H3|ILVC_PROM9 | Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain MIT 9312) GN=ilvC PE=3 SV=1 | 259 | 510 | 6.0E-41 |
sp|Q3AVC2|ILVC_SYNS9 | Ketol-acid reductoisomerase OS=Synechococcus sp. (strain CC9902) GN=ilvC PE=3 SV=1 | 259 | 521 | 6.0E-41 |
sp|Q7V0F0|ILVC_PROMP | Ketol-acid reductoisomerase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=ilvC PE=3 SV=1 | 259 | 510 | 7.0E-41 |
sp|B2UYT8|ILVC_CLOBA | Ketol-acid reductoisomerase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=ilvC PE=3 SV=1 | 259 | 568 | 7.0E-41 |
sp|A0Q0E9|ILVC_CLONN | Ketol-acid reductoisomerase OS=Clostridium novyi (strain NT) GN=ilvC PE=3 SV=1 | 259 | 531 | 8.0E-41 |
sp|A5GMM6|ILVC_SYNPW | Ketol-acid reductoisomerase OS=Synechococcus sp. (strain WH7803) GN=ilvC PE=3 SV=1 | 259 | 577 | 9.0E-41 |
sp|B8CX20|ILVC_HALOH | Ketol-acid reductoisomerase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=ilvC PE=3 SV=1 | 267 | 518 | 1.0E-40 |
sp|Q7U5Q1|ILVC_SYNPX | Ketol-acid reductoisomerase OS=Synechococcus sp. (strain WH8102) GN=ilvC PE=3 SV=1 | 266 | 521 | 1.0E-40 |
sp|A3DIE1|ILVC_CLOTH | Ketol-acid reductoisomerase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ilvC PE=3 SV=1 | 259 | 533 | 1.0E-40 |
sp|Q7W566|ILVC_BORPA | Ketol-acid reductoisomerase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ilvC PE=3 SV=1 | 259 | 579 | 2.0E-40 |
sp|Q7WCP6|ILVC_BORBR | Ketol-acid reductoisomerase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ilvC PE=3 SV=1 | 259 | 579 | 2.0E-40 |
sp|A2BY22|ILVC_PROM5 | Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain MIT 9515) GN=ilvC PE=3 SV=1 | 259 | 510 | 2.0E-40 |
sp|Q65GI7|ILVC_BACLD | Ketol-acid reductoisomerase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ilvC PE=3 SV=1 | 264 | 517 | 2.0E-40 |
sp|Q46FY8|ILVC_METBF | Ketol-acid reductoisomerase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=ilvC PE=3 SV=1 | 256 | 518 | 2.0E-40 |
sp|Q7VGW6|ILVC_HELHP | Ketol-acid reductoisomerase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=ilvC PE=3 SV=1 | 267 | 579 | 2.0E-40 |
sp|B8G7X1|ILVC_CHLAD | Ketol-acid reductoisomerase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=ilvC PE=3 SV=1 | 259 | 579 | 2.0E-40 |
sp|A1AS39|ILVC_PELPD | Ketol-acid reductoisomerase OS=Pelobacter propionicus (strain DSM 2379) GN=ilvC PE=3 SV=1 | 259 | 517 | 2.0E-40 |
sp|Q8EYH2|ILVC_LEPIN | Ketol-acid reductoisomerase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=ilvC PE=3 SV=2 | 246 | 529 | 2.0E-40 |
sp|Q72M00|ILVC_LEPIC | Ketol-acid reductoisomerase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=ilvC PE=3 SV=2 | 246 | 529 | 2.0E-40 |
sp|Q7VAR8|ILVC_PROMA | Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=ilvC PE=3 SV=1 | 259 | 521 | 2.0E-40 |
sp|A9GW78|ILVC_SORC5 | Ketol-acid reductoisomerase OS=Sorangium cellulosum (strain So ce56) GN=ilvC PE=3 SV=1 | 259 | 510 | 2.0E-40 |
sp|B8I1T8|ILVC_CLOCE | Ketol-acid reductoisomerase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=ilvC PE=3 SV=1 | 259 | 531 | 3.0E-40 |
sp|B0KAH3|ILVC_THEP3 | Ketol-acid reductoisomerase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=ilvC PE=3 SV=1 | 259 | 510 | 3.0E-40 |
sp|Q2S0M9|ILVC_SALRD | Ketol-acid reductoisomerase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=ilvC PE=3 SV=1 | 267 | 579 | 3.0E-40 |
sp|A5GRI8|ILVC_SYNR3 | Ketol-acid reductoisomerase OS=Synechococcus sp. (strain RCC307) GN=ilvC PE=3 SV=1 | 259 | 521 | 3.0E-40 |
sp|Q6F821|ILVC_ACIAD | Ketol-acid reductoisomerase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ilvC PE=3 SV=1 | 259 | 510 | 4.0E-40 |
sp|A2C482|ILVC_PROM1 | Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain NATL1A) GN=ilvC PE=3 SV=1 | 266 | 577 | 5.0E-40 |
sp|Q5H4C1|ILVC_XANOR | Ketol-acid reductoisomerase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ilvC PE=3 SV=2 | 267 | 572 | 5.0E-40 |
sp|B2SNG5|ILVC_XANOP | Ketol-acid reductoisomerase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=ilvC PE=3 SV=1 | 267 | 572 | 5.0E-40 |
sp|Q2P757|ILVC_XANOM | Ketol-acid reductoisomerase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ilvC PE=3 SV=1 | 267 | 572 | 5.0E-40 |
sp|A1WUW3|ILVC_HALHL | Ketol-acid reductoisomerase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=ilvC PE=3 SV=1 | 267 | 529 | 5.0E-40 |
sp|Q7VZU4|ILVC_BORPE | Ketol-acid reductoisomerase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ilvC PE=3 SV=1 | 259 | 579 | 6.0E-40 |
sp|Q81F27|ILVC2_BACCR | Ketol-acid reductoisomerase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ilvC2 PE=3 SV=1 | 259 | 518 | 6.0E-40 |
sp|B3PK17|ILVC_CELJU | Ketol-acid reductoisomerase OS=Cellvibrio japonicus (strain Ueda107) GN=ilvC PE=3 SV=1 | 259 | 574 | 7.0E-40 |
sp|A4VXL3|ILVC_STRSY | Ketol-acid reductoisomerase OS=Streptococcus suis (strain 05ZYH33) GN=ilvC PE=3 SV=1 | 264 | 579 | 7.0E-40 |
sp|A4W3V8|ILVC_STRS2 | Ketol-acid reductoisomerase OS=Streptococcus suis (strain 98HAH33) GN=ilvC PE=3 SV=1 | 264 | 579 | 7.0E-40 |
sp|Q75AF2|UBC12_ASHGO | NEDD8-conjugating enzyme UBC12 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=UBC12 PE=3 SV=2 | 1 | 183 | 7.0E-40 |
sp|Q46JF6|ILVC_PROMT | Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain NATL2A) GN=ilvC PE=3 SV=1 | 266 | 577 | 7.0E-40 |
sp|Q8PH09|ILVC_XANAC | Ketol-acid reductoisomerase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ilvC PE=3 SV=1 | 267 | 576 | 7.0E-40 |
sp|Q10WP7|ILVC_TRIEI | Ketol-acid reductoisomerase OS=Trichodesmium erythraeum (strain IMS101) GN=ilvC PE=3 SV=1 | 259 | 515 | 8.0E-40 |
sp|B2TIR4|ILVC_CLOBB | Ketol-acid reductoisomerase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=ilvC PE=3 SV=1 | 259 | 568 | 8.0E-40 |
sp|Q8RDK4|ILVC_CALS4 | Ketol-acid reductoisomerase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=ilvC PE=3 SV=1 | 260 | 579 | 9.0E-40 |
sp|Q2S9V9|ILVC_HAHCH | Ketol-acid reductoisomerase OS=Hahella chejuensis (strain KCTC 2396) GN=ilvC PE=3 SV=1 | 259 | 574 | 1.0E-39 |
sp|A8ERD8|ILVC_ARCB4 | Ketol-acid reductoisomerase OS=Arcobacter butzleri (strain RM4018) GN=ilvC PE=3 SV=1 | 259 | 574 | 1.0E-39 |
sp|Q1GZE9|ILVC_METFK | Ketol-acid reductoisomerase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=ilvC PE=3 SV=1 | 267 | 517 | 1.0E-39 |
sp|P29107|ILVC_SYNY3 | Ketol-acid reductoisomerase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ilvC PE=1 SV=3 | 259 | 518 | 1.0E-39 |
sp|Q2KWH7|ILVC_BORA1 | Ketol-acid reductoisomerase OS=Bordetella avium (strain 197N) GN=ilvC PE=3 SV=1 | 259 | 517 | 1.0E-39 |
sp|A1AW99|ILVC_RUTMC | Ketol-acid reductoisomerase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=ilvC PE=3 SV=1 | 259 | 579 | 2.0E-39 |
sp|Q73A47|ILVC2_BACC1 | Ketol-acid reductoisomerase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ilvC2 PE=3 SV=1 | 259 | 510 | 2.0E-39 |
sp|Q971A9|ILVC_SULTO | Ketol-acid reductoisomerase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=ilvC PE=3 SV=1 | 259 | 510 | 2.0E-39 |
sp|P65153|ILVC_STAAW | Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain MW2) GN=ilvC PE=3 SV=1 | 262 | 588 | 2.0E-39 |
sp|Q6GF17|ILVC_STAAR | Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain MRSA252) GN=ilvC PE=3 SV=1 | 262 | 588 | 2.0E-39 |
sp|P65152|ILVC_STAAN | Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain N315) GN=ilvC PE=3 SV=1 | 262 | 588 | 2.0E-39 |
sp|P65151|ILVC_STAAM | Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ilvC PE=3 SV=1 | 262 | 588 | 2.0E-39 |
sp|Q2YUF3|ILVC_STAAB | Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ilvC PE=3 SV=1 | 262 | 588 | 2.0E-39 |
sp|A5IUK2|ILVC_STAA9 | Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain JH9) GN=ilvC PE=3 SV=1 | 262 | 588 | 2.0E-39 |
sp|A6U3E1|ILVC_STAA2 | Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain JH1) GN=ilvC PE=3 SV=1 | 262 | 588 | 2.0E-39 |
sp|A7X4M9|ILVC_STAA1 | Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=ilvC PE=3 SV=1 | 262 | 588 | 2.0E-39 |
sp|Q8DGR0|ILVC_THEEB | Ketol-acid reductoisomerase OS=Thermosynechococcus elongatus (strain BP-1) GN=ilvC PE=3 SV=2 | 250 | 568 | 2.0E-39 |
sp|B4U6I9|ILVC_HYDS0 | Ketol-acid reductoisomerase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=ilvC PE=3 SV=1 | 266 | 587 | 2.0E-39 |
sp|B0V5G8|ILVC_ACIBY | Ketol-acid reductoisomerase OS=Acinetobacter baumannii (strain AYE) GN=ilvC PE=3 SV=1 | 259 | 501 | 2.0E-39 |
sp|A3M254|ILVC_ACIBT | Ketol-acid reductoisomerase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=ilvC PE=3 SV=2 | 259 | 501 | 2.0E-39 |
sp|B0VKP5|ILVC_ACIBS | Ketol-acid reductoisomerase OS=Acinetobacter baumannii (strain SDF) GN=ilvC PE=3 SV=1 | 259 | 501 | 2.0E-39 |
sp|B2HTC8|ILVC_ACIBC | Ketol-acid reductoisomerase OS=Acinetobacter baumannii (strain ACICU) GN=ilvC PE=3 SV=1 | 259 | 501 | 2.0E-39 |
sp|B7I5I9|ILVC_ACIB5 | Ketol-acid reductoisomerase OS=Acinetobacter baumannii (strain AB0057) GN=ilvC PE=3 SV=1 | 259 | 501 | 2.0E-39 |
sp|B7H047|ILVC_ACIB3 | Ketol-acid reductoisomerase OS=Acinetobacter baumannii (strain AB307-0294) GN=ilvC PE=3 SV=1 | 259 | 501 | 2.0E-39 |
sp|B8J2E2|ILVC_DESDA | Ketol-acid reductoisomerase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=ilvC PE=3 SV=1 | 259 | 579 | 3.0E-39 |
sp|B1XL20|ILVC_SYNP2 | Ketol-acid reductoisomerase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=ilvC PE=3 SV=1 | 250 | 510 | 3.0E-39 |
sp|Q1QDE6|ILVC_PSYCK | Ketol-acid reductoisomerase OS=Psychrobacter cryohalolentis (strain K5) GN=ilvC PE=3 SV=1 | 259 | 510 | 3.0E-39 |
sp|A9BME9|ILVC_DELAS | Ketol-acid reductoisomerase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=ilvC PE=3 SV=1 | 259 | 510 | 3.0E-39 |
sp|Q87CM2|ILVC_XYLFT | Ketol-acid reductoisomerase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ilvC PE=3 SV=1 | 267 | 576 | 3.0E-39 |
sp|B9LGM7|ILVC_CHLSY | Ketol-acid reductoisomerase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=ilvC PE=3 SV=1 | 259 | 579 | 3.0E-39 |
sp|A9WC26|ILVC_CHLAA | Ketol-acid reductoisomerase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=ilvC PE=3 SV=1 | 259 | 579 | 3.0E-39 |
sp|Q63CV4|ILVC2_BACCZ | Ketol-acid reductoisomerase 2 OS=Bacillus cereus (strain ZK / E33L) GN=ilvC2 PE=3 SV=1 | 259 | 510 | 3.0E-39 |
sp|Q4FUB6|ILVC_PSYA2 | Ketol-acid reductoisomerase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=ilvC PE=3 SV=1 | 259 | 510 | 4.0E-39 |
sp|A5CWZ1|ILVC_VESOH | Ketol-acid reductoisomerase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=ilvC PE=3 SV=1 | 267 | 530 | 5.0E-39 |
sp|Q4L7T9|ILVC_STAHJ | Ketol-acid reductoisomerase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ilvC PE=3 SV=1 | 252 | 579 | 5.0E-39 |
sp|A8AVN4|ILVC_STRGC | Ketol-acid reductoisomerase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=ilvC PE=3 SV=1 | 264 | 579 | 5.0E-39 |
sp|Q5M2F2|ILVC_STRT2 | Ketol-acid reductoisomerase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=ilvC PE=3 SV=1 | 264 | 579 | 5.0E-39 |
sp|Q5LXV0|ILVC_STRT1 | Ketol-acid reductoisomerase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=ilvC PE=3 SV=1 | 264 | 579 | 5.0E-39 |
sp|Q9F0I7|ILVC_STRTR | Ketol-acid reductoisomerase OS=Streptococcus thermophilus GN=ilvC PE=3 SV=1 | 264 | 579 | 5.0E-39 |
sp|Q03IJ9|ILVC_STRTD | Ketol-acid reductoisomerase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=ilvC PE=3 SV=1 | 264 | 579 | 5.0E-39 |
sp|A6LPX8|ILVC_CLOB8 | Ketol-acid reductoisomerase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=ilvC PE=3 SV=1 | 259 | 531 | 6.0E-39 |
sp|Q81S27|ILVC2_BACAN | Ketol-acid reductoisomerase 2 OS=Bacillus anthracis GN=ilvC2 PE=3 SV=1 | 262 | 510 | 8.0E-39 |
sp|A6SZZ1|ILVC_JANMA | Ketol-acid reductoisomerase OS=Janthinobacterium sp. (strain Marseille) GN=ilvC PE=3 SV=1 | 259 | 517 | 8.0E-39 |
sp|Q6HKA1|ILVC2_BACHK | Ketol-acid reductoisomerase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ilvC2 PE=3 SV=1 | 262 | 510 | 8.0E-39 |
sp|B2ILY8|ILVC_STRPS | Ketol-acid reductoisomerase OS=Streptococcus pneumoniae (strain CGSP14) GN=ilvC PE=3 SV=1 | 264 | 579 | 8.0E-39 |
sp|A7ZEF1|ILVC_CAMC1 | Ketol-acid reductoisomerase OS=Campylobacter concisus (strain 13826) GN=ilvC PE=3 SV=1 | 259 | 510 | 9.0E-39 |
sp|Q056H8|ILVC_LEPBL | Ketol-acid reductoisomerase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=ilvC PE=3 SV=1 | 259 | 529 | 1.0E-38 |
sp|Q04P56|ILVC_LEPBJ | Ketol-acid reductoisomerase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=ilvC PE=3 SV=1 | 259 | 529 | 1.0E-38 |
sp|Q9PCF9|ILVC_XYLFA | Ketol-acid reductoisomerase OS=Xylella fastidiosa (strain 9a5c) GN=ilvC PE=3 SV=2 | 251 | 576 | 1.0E-38 |
sp|C1CPV5|ILVC_STRZT | Ketol-acid reductoisomerase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=ilvC PE=3 SV=1 | 264 | 579 | 1.0E-38 |
sp|C1CIU7|ILVC_STRZP | Ketol-acid reductoisomerase OS=Streptococcus pneumoniae (strain P1031) GN=ilvC PE=3 SV=1 | 264 | 579 | 1.0E-38 |
sp|C1CCK9|ILVC_STRZJ | Ketol-acid reductoisomerase OS=Streptococcus pneumoniae (strain JJA) GN=ilvC PE=3 SV=1 | 264 | 579 | 1.0E-38 |
sp|Q8DR03|ILVC_STRR6 | Ketol-acid reductoisomerase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ilvC PE=3 SV=1 | 264 | 579 | 1.0E-38 |
sp|Q97SD7|ILVC_STRPN | Ketol-acid reductoisomerase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ilvC PE=3 SV=2 | 264 | 579 | 1.0E-38 |
sp|B8ZLL0|ILVC_STRPJ | Ketol-acid reductoisomerase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=ilvC PE=3 SV=1 | 264 | 579 | 1.0E-38 |
sp|C1C5I0|ILVC_STRP7 | Ketol-acid reductoisomerase OS=Streptococcus pneumoniae (strain 70585) GN=ilvC PE=3 SV=1 | 264 | 579 | 1.0E-38 |
sp|Q04M32|ILVC_STRP2 | Ketol-acid reductoisomerase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=ilvC PE=3 SV=1 | 264 | 579 | 1.0E-38 |
sp|A4G4H8|ILVC_HERAR | Ketol-acid reductoisomerase OS=Herminiimonas arsenicoxydans GN=ilvC PE=3 SV=1 | 259 | 518 | 1.0E-38 |
sp|Q03UU4|ILVC_LEUMM | Ketol-acid reductoisomerase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=ilvC PE=3 SV=1 | 267 | 579 | 1.0E-38 |
sp|A3CQ86|ILVC_STRSV | Ketol-acid reductoisomerase OS=Streptococcus sanguinis (strain SK36) GN=ilvC PE=3 SV=1 | 264 | 579 | 1.0E-38 |
sp|B8HNI6|ILVC_CYAP4 | Ketol-acid reductoisomerase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=ilvC PE=3 SV=1 | 259 | 515 | 1.0E-38 |
sp|A9IGJ3|ILVC_BORPD | Ketol-acid reductoisomerase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=ilvC PE=3 SV=1 | 259 | 518 | 1.0E-38 |
sp|B5YJT0|ILVC_THEYD | Ketol-acid reductoisomerase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=ilvC PE=3 SV=1 | 260 | 529 | 1.0E-38 |
sp|Q3AEQ7|ILVC_CARHZ | Ketol-acid reductoisomerase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=ilvC PE=3 SV=1 | 259 | 529 | 1.0E-38 |
sp|Q2NI95|ILVC_METST | Ketol-acid reductoisomerase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=ilvC PE=3 SV=1 | 266 | 531 | 2.0E-38 |
sp|Q473V5|ILVC_CUPPJ | Ketol-acid reductoisomerase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ilvC PE=3 SV=1 | 259 | 518 | 2.0E-38 |
sp|Q6G7Q2|ILVC_STAAS | Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain MSSA476) GN=ilvC PE=3 SV=1 | 262 | 588 | 2.0E-38 |
sp|Q1J0T2|ILVC_DEIGD | Ketol-acid reductoisomerase OS=Deinococcus geothermalis (strain DSM 11300) GN=ilvC PE=3 SV=1 | 267 | 587 | 2.0E-38 |
sp|A5G7V3|ILVC_GEOUR | Ketol-acid reductoisomerase OS=Geobacter uraniireducens (strain Rf4) GN=ilvC PE=3 SV=1 | 259 | 529 | 2.0E-38 |
sp|B1I9N6|ILVC_STRPI | Ketol-acid reductoisomerase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=ilvC PE=3 SV=1 | 264 | 579 | 2.0E-38 |
sp|B9DMJ5|ILVC_STACT | Ketol-acid reductoisomerase OS=Staphylococcus carnosus (strain TM300) GN=ilvC PE=3 SV=1 | 262 | 588 | 2.0E-38 |
sp|A6VCE7|ILVC_PSEA7 | Ketol-acid reductoisomerase OS=Pseudomonas aeruginosa (strain PA7) GN=ilvC PE=3 SV=1 | 259 | 521 | 2.0E-38 |
sp|Q0AV19|ILVC_SYNWW | Ketol-acid reductoisomerase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=ilvC PE=3 SV=1 | 259 | 540 | 2.0E-38 |
sp|B3EKV1|ILVC_CHLPB | Ketol-acid reductoisomerase OS=Chlorobium phaeobacteroides (strain BS1) GN=ilvC PE=3 SV=1 | 259 | 517 | 3.0E-38 |
sp|Q2RIS6|ILVC_MOOTA | Ketol-acid reductoisomerase OS=Moorella thermoacetica (strain ATCC 39073) GN=ilvC PE=3 SV=1 | 259 | 533 | 3.0E-38 |
sp|Q9HVA2|ILVC_PSEAE | Ketol-acid reductoisomerase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ilvC PE=1 SV=1 | 259 | 521 | 3.0E-38 |
sp|Q02FX9|ILVC_PSEAB | Ketol-acid reductoisomerase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ilvC PE=3 SV=1 | 259 | 521 | 3.0E-38 |
sp|B7V1A6|ILVC_PSEA8 | Ketol-acid reductoisomerase OS=Pseudomonas aeruginosa (strain LESB58) GN=ilvC PE=3 SV=1 | 259 | 521 | 3.0E-38 |
sp|A8Z4V9|ILVC_STAAT | Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=ilvC PE=3 SV=1 | 262 | 588 | 3.0E-38 |
sp|A6QIQ2|ILVC_STAAE | Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain Newman) GN=ilvC PE=3 SV=1 | 262 | 588 | 3.0E-38 |
sp|Q5HEE5|ILVC_STAAC | Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain COL) GN=ilvC PE=3 SV=1 | 262 | 588 | 3.0E-38 |
sp|Q2FWK4|ILVC_STAA8 | Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain NCTC 8325) GN=ilvC PE=3 SV=1 | 262 | 588 | 3.0E-38 |
sp|Q2FF68|ILVC_STAA3 | Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain USA300) GN=ilvC PE=3 SV=1 | 262 | 588 | 3.0E-38 |
sp|A9AZM5|ILVC_HERA2 | Ketol-acid reductoisomerase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=ilvC PE=3 SV=1 | 264 | 579 | 3.0E-38 |
sp|B4UAN4|ILVC_ANASK | Ketol-acid reductoisomerase OS=Anaeromyxobacter sp. (strain K) GN=ilvC PE=3 SV=1 | 259 | 515 | 3.0E-38 |
sp|A1TRT6|ILVC_ACIAC | Ketol-acid reductoisomerase OS=Acidovorax citrulli (strain AAC00-1) GN=ilvC PE=3 SV=1 | 259 | 510 | 3.0E-38 |
sp|Q3BPK3|ILVC_XANC5 | Ketol-acid reductoisomerase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ilvC PE=3 SV=1 | 267 | 576 | 4.0E-38 |
sp|Q2IJB7|ILVC_ANADE | Ketol-acid reductoisomerase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=ilvC PE=3 SV=1 | 259 | 515 | 4.0E-38 |
sp|B8J829|ILVC_ANAD2 | Ketol-acid reductoisomerase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=ilvC PE=3 SV=1 | 259 | 515 | 4.0E-38 |
sp|B8GUB6|ILVC_THISH | Ketol-acid reductoisomerase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=ilvC PE=3 SV=1 | 259 | 517 | 4.0E-38 |
sp|Q5V520|ILVC_HALMA | Ketol-acid reductoisomerase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=ilvC PE=3 SV=1 | 265 | 512 | 4.0E-38 |
sp|A6TTL2|ILVC_ALKMQ | Ketol-acid reductoisomerase OS=Alkaliphilus metalliredigens (strain QYMF) GN=ilvC PE=3 SV=1 | 259 | 531 | 8.0E-38 |
sp|B3E5X4|ILVC_GEOLS | Ketol-acid reductoisomerase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=ilvC PE=3 SV=1 | 259 | 541 | 8.0E-38 |
sp|A6Q461|ILVC_NITSB | Ketol-acid reductoisomerase OS=Nitratiruptor sp. (strain SB155-2) GN=ilvC PE=3 SV=1 | 259 | 579 | 8.0E-38 |
sp|Q3SHE4|ILVC_THIDA | Ketol-acid reductoisomerase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=ilvC PE=3 SV=1 | 259 | 510 | 8.0E-38 |
sp|Q47SB6|ILVC_THEFY | Ketol-acid reductoisomerase OS=Thermobifida fusca (strain YX) GN=ilvC PE=3 SV=1 | 259 | 577 | 8.0E-38 |
sp|Q0W834|ILVC_METAR | Ketol-acid reductoisomerase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=ilvC PE=3 SV=1 | 259 | 512 | 9.0E-38 |
sp|Q39W76|ILVC_GEOMG | Ketol-acid reductoisomerase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=ilvC PE=3 SV=1 | 262 | 529 | 9.0E-38 |
sp|B4S6N3|ILVC_PROA2 | Ketol-acid reductoisomerase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=ilvC PE=3 SV=1 | 259 | 531 | 1.0E-37 |
sp|B4SDK7|ILVC_PELPB | Ketol-acid reductoisomerase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=ilvC PE=3 SV=1 | 259 | 588 | 1.0E-37 |
sp|Q1LPX7|ILVC_CUPMC | Ketol-acid reductoisomerase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ilvC PE=3 SV=1 | 259 | 517 | 1.0E-37 |
sp|B3R3V4|ILVC_CUPTR | Ketol-acid reductoisomerase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=ilvC PE=3 SV=1 | 259 | 517 | 1.0E-37 |
sp|B9EBF4|ILVC_MACCJ | Ketol-acid reductoisomerase OS=Macrococcus caseolyticus (strain JCSC5402) GN=ilvC PE=3 SV=1 | 260 | 577 | 1.0E-37 |
sp|Q3B594|ILVC_CHLL7 | Ketol-acid reductoisomerase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=ilvC PE=3 SV=1 | 246 | 588 | 1.0E-37 |
sp|Q3J875|ILVC_NITOC | Ketol-acid reductoisomerase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ilvC PE=3 SV=1 | 259 | 518 | 2.0E-37 |
sp|C1CWT7|ILVC_DEIDV | Ketol-acid reductoisomerase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=ilvC PE=3 SV=1 | 267 | 518 | 2.0E-37 |
sp|Q6CSW8|UBC12_KLULA | NEDD8-conjugating enzyme UBC12 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=UBC12 PE=3 SV=1 | 19 | 184 | 2.0E-37 |
sp|A1UT97|ILVC_BARBK | Ketol-acid reductoisomerase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ilvC PE=3 SV=1 | 267 | 517 | 2.0E-37 |
sp|Q1ILZ3|ILVC_KORVE | Ketol-acid reductoisomerase OS=Koribacter versatilis (strain Ellin345) GN=ilvC PE=3 SV=1 | 259 | 577 | 2.0E-37 |
sp|A4YI15|ILVC_METS5 | Ketol-acid reductoisomerase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=ilvC PE=3 SV=1 | 259 | 512 | 2.0E-37 |
sp|A1W6T4|ILVC_ACISJ | Ketol-acid reductoisomerase OS=Acidovorax sp. (strain JS42) GN=ilvC PE=3 SV=1 | 259 | 510 | 2.0E-37 |
sp|B9MA35|ILVC_ACIET | Ketol-acid reductoisomerase OS=Acidovorax ebreus (strain TPSY) GN=ilvC PE=3 SV=1 | 259 | 510 | 2.0E-37 |
sp|A7NJH8|ILVC_ROSCS | Ketol-acid reductoisomerase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=ilvC PE=3 SV=1 | 259 | 518 | 3.0E-37 |
sp|Q31HZ1|ILVC_THICR | Ketol-acid reductoisomerase OS=Thiomicrospira crunogena (strain XCL-2) GN=ilvC PE=3 SV=1 | 259 | 517 | 3.0E-37 |
sp|Q2YBU1|ILVC_NITMU | Ketol-acid reductoisomerase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=ilvC PE=3 SV=1 | 259 | 517 | 3.0E-37 |
sp|B5E1Q6|ILVC_STRP4 | Ketol-acid reductoisomerase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=ilvC PE=3 SV=1 | 264 | 579 | 3.0E-37 |
sp|Q0AB89|ILVC_ALKEH | Ketol-acid reductoisomerase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=ilvC PE=3 SV=1 | 259 | 517 | 4.0E-37 |
sp|B3EHP0|ILVC_CHLL2 | Ketol-acid reductoisomerase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=ilvC PE=3 SV=1 | 259 | 588 | 4.0E-37 |
sp|Q605K9|ILVC_METCA | Ketol-acid reductoisomerase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ilvC PE=3 SV=1 | 259 | 518 | 4.0E-37 |
sp|Q9RU74|ILVC_DEIRA | Ketol-acid reductoisomerase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ilvC PE=3 SV=2 | 267 | 518 | 4.0E-37 |
sp|Q5NXP4|ILVC_AROAE | Ketol-acid reductoisomerase OS=Aromatoleum aromaticum (strain EbN1) GN=ilvC PE=3 SV=1 | 259 | 510 | 5.0E-37 |
sp|Q8FPX1|ILVC_COREF | Ketol-acid reductoisomerase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=ilvC PE=3 SV=2 | 259 | 541 | 5.0E-37 |
sp|C1DFH7|ILVC_AZOVD | Ketol-acid reductoisomerase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ilvC PE=1 SV=1 | 259 | 501 | 5.0E-37 |
sp|Q5F7E5|ILVC_NEIG1 | Ketol-acid reductoisomerase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=ilvC PE=3 SV=1 | 259 | 521 | 5.0E-37 |
sp|Q4J8K9|ILVC_SULAC | Ketol-acid reductoisomerase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=ilvC PE=3 SV=1 | 259 | 512 | 6.0E-37 |
sp|P97115|ILVC_LEUMC | Ketol-acid reductoisomerase OS=Leuconostoc mesenteroides subsp. cremoris GN=ilvC PE=3 SV=1 | 267 | 579 | 6.0E-37 |
sp|A4VPI6|ILVC_PSEU5 | Ketol-acid reductoisomerase OS=Pseudomonas stutzeri (strain A1501) GN=ilvC PE=3 SV=1 | 259 | 521 | 6.0E-37 |
sp|A4SXR3|ILVC_POLSQ | Ketol-acid reductoisomerase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=ilvC PE=3 SV=1 | 259 | 517 | 6.0E-37 |
sp|Q3Z891|ILVC_DEHM1 | Ketol-acid reductoisomerase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=ilvC PE=3 SV=1 | 267 | 568 | 7.0E-37 |
sp|A1KUZ8|ILVC_NEIMF | Ketol-acid reductoisomerase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=ilvC PE=3 SV=1 | 259 | 521 | 8.0E-37 |
sp|Q9JYI2|ILVC_NEIMB | Ketol-acid reductoisomerase OS=Neisseria meningitidis serogroup B (strain MC58) GN=ilvC PE=3 SV=1 | 259 | 521 | 8.0E-37 |
sp|A9M177|ILVC_NEIM0 | Ketol-acid reductoisomerase OS=Neisseria meningitidis serogroup C (strain 053442) GN=ilvC PE=3 SV=1 | 259 | 521 | 8.0E-37 |
sp|A1KAB7|ILVC_AZOSB | Ketol-acid reductoisomerase OS=Azoarcus sp. (strain BH72) GN=ilvC PE=3 SV=1 | 259 | 521 | 8.0E-37 |
sp|B2U7S3|ILVC_RALPJ | Ketol-acid reductoisomerase OS=Ralstonia pickettii (strain 12J) GN=ilvC PE=3 SV=1 | 259 | 579 | 8.0E-37 |
sp|Q9JTI3|ILVC_NEIMA | Ketol-acid reductoisomerase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ilvC PE=3 SV=1 | 259 | 521 | 8.0E-37 |
sp|Q24XT5|ILVC_DESHY | Ketol-acid reductoisomerase OS=Desulfitobacterium hafniense (strain Y51) GN=ilvC PE=3 SV=1 | 259 | 510 | 1.0E-36 |
sp|B8FU98|ILVC_DESHD | Ketol-acid reductoisomerase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=ilvC PE=3 SV=1 | 259 | 510 | 1.0E-36 |
sp|Q12Y03|ILVC_METBU | Ketol-acid reductoisomerase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=ilvC PE=3 SV=1 | 262 | 518 | 1.0E-36 |
sp|B1XUJ0|ILVC_POLNS | Ketol-acid reductoisomerase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=ilvC PE=3 SV=1 | 259 | 517 | 1.0E-36 |
sp|Q3APC3|ILVC_CHLCH | Ketol-acid reductoisomerase OS=Chlorobium chlorochromatii (strain CaD3) GN=ilvC PE=3 SV=1 | 259 | 531 | 1.0E-36 |
sp|Q30T61|ILVC_SULDN | Ketol-acid reductoisomerase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=ilvC PE=3 SV=2 | 259 | 510 | 1.0E-36 |
sp|Q0KCU2|ILVC_CUPNH | Ketol-acid reductoisomerase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ilvC PE=3 SV=1 | 259 | 517 | 1.0E-36 |
sp|A9VZF3|ILVC_METEP | Ketol-acid reductoisomerase OS=Methylobacterium extorquens (strain PA1) GN=ilvC PE=3 SV=1 | 259 | 533 | 1.0E-36 |
sp|B7KYZ3|ILVC_METC4 | Ketol-acid reductoisomerase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=ilvC PE=3 SV=1 | 259 | 533 | 1.0E-36 |
sp|B7K0S6|ILVC_CYAP8 | Ketol-acid reductoisomerase OS=Cyanothece sp. (strain PCC 8801) GN=ilvC PE=3 SV=1 | 250 | 518 | 2.0E-36 |
sp|B9KYS1|ILVC_THERP | Ketol-acid reductoisomerase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=ilvC PE=3 SV=1 | 259 | 517 | 2.0E-36 |
sp|Q8XXN8|ILVC_RALSO | Ketol-acid reductoisomerase OS=Ralstonia solanacearum (strain GMI1000) GN=ilvC PE=3 SV=1 | 259 | 521 | 2.0E-36 |
sp|A8I679|ILVC_AZOC5 | Ketol-acid reductoisomerase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=ilvC PE=3 SV=1 | 259 | 574 | 3.0E-36 |
sp|Q47BH8|ILVC_DECAR | Ketol-acid reductoisomerase OS=Dechloromonas aromatica (strain RCB) GN=ilvC PE=3 SV=1 | 259 | 510 | 3.0E-36 |
sp|A1VN04|ILVC_POLNA | Ketol-acid reductoisomerase OS=Polaromonas naphthalenivorans (strain CJ2) GN=ilvC PE=3 SV=1 | 259 | 518 | 3.0E-36 |
sp|B0U8N5|ILVC_METS4 | Ketol-acid reductoisomerase OS=Methylobacterium sp. (strain 4-46) GN=ilvC PE=3 SV=1 | 259 | 518 | 3.0E-36 |
sp|Q3ZXI2|ILVC_DEHMC | Ketol-acid reductoisomerase OS=Dehalococcoides mccartyi (strain CBDB1) GN=ilvC PE=3 SV=1 | 267 | 568 | 3.0E-36 |
sp|Q0VSB5|ILVC_ALCBS | Ketol-acid reductoisomerase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=ilvC PE=3 SV=2 | 259 | 482 | 4.0E-36 |
sp|Q0RDI8|ILVC_FRAAA | Ketol-acid reductoisomerase OS=Frankia alni (strain ACN14a) GN=ilvC PE=3 SV=1 | 259 | 577 | 4.0E-36 |
sp|A1BES5|ILVC_CHLPD | Ketol-acid reductoisomerase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=ilvC PE=3 SV=1 | 259 | 531 | 4.0E-36 |
sp|A5FR44|ILVC_DEHMB | Ketol-acid reductoisomerase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=ilvC PE=3 SV=1 | 267 | 568 | 4.0E-36 |
sp|C5BQZ6|ILVC_TERTT | Ketol-acid reductoisomerase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=ilvC PE=3 SV=1 | 259 | 579 | 5.0E-36 |
sp|O27491|ILVC_METTH | Ketol-acid reductoisomerase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ilvC PE=3 SV=2 | 259 | 512 | 5.0E-36 |
sp|Q3K6T1|ILVC_PSEPF | Ketol-acid reductoisomerase OS=Pseudomonas fluorescens (strain Pf0-1) GN=ilvC PE=3 SV=1 | 259 | 521 | 8.0E-36 |
sp|Q4K608|ILVC_PSEF5 | Ketol-acid reductoisomerase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ilvC PE=3 SV=1 | 259 | 521 | 8.0E-36 |
sp|C4XSF4|ILVC_DESMR | Ketol-acid reductoisomerase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=ilvC PE=3 SV=1 | 266 | 510 | 9.0E-36 |
sp|Q7UKY0|ILVC_RHOBA | Ketol-acid reductoisomerase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ilvC PE=3 SV=1 | 259 | 518 | 9.0E-36 |
sp|Q142I6|ILVC_BURXL | Ketol-acid reductoisomerase OS=Burkholderia xenovorans (strain LB400) GN=ilvC PE=3 SV=1 | 259 | 529 | 9.0E-36 |
sp|B2T2D1|ILVC_BURPP | Ketol-acid reductoisomerase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=ilvC PE=3 SV=1 | 259 | 529 | 1.0E-35 |
sp|Q888N4|ILVC_PSESM | Ketol-acid reductoisomerase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ilvC PE=3 SV=1 | 259 | 521 | 1.0E-35 |
sp|A1TZ11|ILVC_MARHV | Ketol-acid reductoisomerase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ilvC PE=3 SV=1 | 259 | 510 | 1.0E-35 |
sp|Q4ZY66|ILVC_PSEU2 | Ketol-acid reductoisomerase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ilvC PE=3 SV=1 | 259 | 521 | 1.0E-35 |
sp|Q48N66|ILVC_PSE14 | Ketol-acid reductoisomerase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ilvC PE=3 SV=1 | 259 | 521 | 1.0E-35 |
sp|Q18C83|ILVC_PEPD6 | Ketol-acid reductoisomerase OS=Peptoclostridium difficile (strain 630) GN=ilvC PE=3 SV=1 | 259 | 577 | 1.0E-35 |
sp|B8DVE0|ILVC_BIFA0 | Ketol-acid reductoisomerase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=ilvC PE=3 SV=1 | 259 | 561 | 1.0E-35 |
sp|A4SFC5|ILVC_CHLPM | Ketol-acid reductoisomerase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=ilvC PE=3 SV=1 | 259 | 531 | 2.0E-35 |
sp|C5CYN9|ILVC_VARPS | Ketol-acid reductoisomerase OS=Variovorax paradoxus (strain S110) GN=ilvC PE=3 SV=1 | 259 | 518 | 2.0E-35 |
sp|Q12B50|ILVC_POLSJ | Ketol-acid reductoisomerase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=ilvC PE=3 SV=1 | 259 | 510 | 2.0E-35 |
sp|C3K225|ILVC_PSEFS | Ketol-acid reductoisomerase OS=Pseudomonas fluorescens (strain SBW25) GN=ilvC PE=3 SV=1 | 259 | 521 | 2.0E-35 |
sp|Q82UZ3|ILVC_NITEU | Ketol-acid reductoisomerase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=ilvC PE=3 SV=1 | 259 | 518 | 2.0E-35 |
sp|B9M5B1|ILVC_GEODF | Ketol-acid reductoisomerase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=ilvC PE=3 SV=1 | 259 | 579 | 2.0E-35 |
sp|Q74BW9|ILVC_GEOSL | Ketol-acid reductoisomerase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=ilvC PE=3 SV=1 | 262 | 517 | 3.0E-35 |
sp|Q8G6V2|ILVC1_BIFLO | Ketol-acid reductoisomerase 1 OS=Bifidobacterium longum (strain NCC 2705) GN=ilvC1 PE=3 SV=2 | 247 | 510 | 4.0E-35 |
sp|B1LXF3|ILVC_METRJ | Ketol-acid reductoisomerase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=ilvC PE=3 SV=1 | 259 | 579 | 4.0E-35 |
sp|Q6A7Z2|ILVC_PROAC | Ketol-acid reductoisomerase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=ilvC PE=3 SV=1 | 267 | 510 | 4.0E-35 |
sp|B1ZI53|ILVC_METPB | Ketol-acid reductoisomerase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=ilvC PE=3 SV=1 | 259 | 533 | 5.0E-35 |
sp|Q9X5F8|ILVC_ZYMMO | Ketol-acid reductoisomerase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ilvC PE=3 SV=1 | 259 | 570 | 5.0E-35 |
sp|A7IFE5|ILVC_XANP2 | Ketol-acid reductoisomerase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=ilvC PE=3 SV=1 | 259 | 518 | 7.0E-35 |
sp|A0B5E0|ILVC_METTP | Ketol-acid reductoisomerase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=ilvC PE=3 SV=1 | 259 | 512 | 1.0E-34 |
sp|A4XR11|ILVC_PSEMY | Ketol-acid reductoisomerase OS=Pseudomonas mendocina (strain ymp) GN=ilvC PE=3 SV=1 | 259 | 521 | 1.0E-34 |
sp|Q1ARE4|ILVC_RUBXD | Ketol-acid reductoisomerase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=ilvC PE=3 SV=1 | 267 | 517 | 1.0E-34 |
sp|A7HVZ2|ILVC_PARL1 | Ketol-acid reductoisomerase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=ilvC PE=3 SV=1 | 262 | 518 | 1.0E-34 |
sp|A8MDY9|ILVC_CALMQ | Ketol-acid reductoisomerase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=ilvC PE=3 SV=1 | 259 | 565 | 1.0E-34 |
sp|Q2SZP8|ILVC_BURTA | Ketol-acid reductoisomerase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ilvC PE=3 SV=1 | 259 | 517 | 1.0E-34 |
sp|A9IW67|ILVC_BART1 | Ketol-acid reductoisomerase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=ilvC PE=3 SV=1 | 259 | 579 | 2.0E-34 |
sp|A9GZJ4|ILVC_GLUDA | Ketol-acid reductoisomerase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=ilvC PE=3 SV=1 | 267 | 568 | 2.0E-34 |
sp|B6JB83|ILVC_OLICO | Ketol-acid reductoisomerase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=ilvC PE=3 SV=1 | 259 | 521 | 2.0E-34 |
sp|Q1I4R5|ILVC_PSEE4 | Ketol-acid reductoisomerase OS=Pseudomonas entomophila (strain L48) GN=ilvC PE=3 SV=1 | 259 | 510 | 2.0E-34 |
sp|Q2NAU8|ILVC_ERYLH | Ketol-acid reductoisomerase OS=Erythrobacter litoralis (strain HTCC2594) GN=ilvC PE=3 SV=1 | 267 | 518 | 2.0E-34 |
sp|A5WD25|ILVC_PSYWF | Ketol-acid reductoisomerase OS=Psychrobacter sp. (strain PRwf-1) GN=ilvC PE=3 SV=1 | 259 | 510 | 2.0E-34 |
sp|Q8KER7|ILVC_CHLTE | Ketol-acid reductoisomerase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=ilvC PE=3 SV=1 | 259 | 517 | 2.0E-34 |
sp|Q02138|ILVC_LACLA | Ketol-acid reductoisomerase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ilvC PE=3 SV=2 | 264 | 582 | 2.0E-34 |
sp|Q1QJU8|ILVC_NITHX | Ketol-acid reductoisomerase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ilvC PE=3 SV=1 | 259 | 529 | 2.0E-34 |
sp|Q89G50|ILVC_BRADU | Ketol-acid reductoisomerase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ilvC PE=3 SV=1 | 259 | 521 | 2.0E-34 |
sp|Q5FRY8|ILVC_GLUOX | Ketol-acid reductoisomerase OS=Gluconobacter oxydans (strain 621H) GN=ilvC PE=3 SV=1 | 259 | 518 | 3.0E-34 |
sp|B0CE35|ILVC_ACAM1 | Ketol-acid reductoisomerase OS=Acaryochloris marina (strain MBIC 11017) GN=ilvC PE=3 SV=1 | 259 | 568 | 3.0E-34 |
sp|B3QCW2|ILVC_RHOPT | Ketol-acid reductoisomerase OS=Rhodopseudomonas palustris (strain TIE-1) GN=ilvC PE=3 SV=1 | 259 | 518 | 3.0E-34 |
sp|Q6N869|ILVC_RHOPA | Ketol-acid reductoisomerase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ilvC PE=3 SV=1 | 259 | 518 | 3.0E-34 |
sp|Q21HN0|ILVC_SACD2 | Ketol-acid reductoisomerase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ilvC PE=3 SV=1 | 259 | 517 | 3.0E-34 |
sp|A4YZA6|ILVC_BRASO | Ketol-acid reductoisomerase OS=Bradyrhizobium sp. (strain ORS278) GN=ilvC PE=3 SV=1 | 259 | 518 | 4.0E-34 |
sp|Q1GT37|ILVC_SPHAL | Ketol-acid reductoisomerase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=ilvC PE=3 SV=1 | 260 | 570 | 4.0E-34 |
sp|Q39ED2|ILVC_BURL3 | Ketol-acid reductoisomerase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ilvC PE=3 SV=1 | 259 | 518 | 4.0E-34 |
sp|A5EPB5|ILVC_BRASB | Ketol-acid reductoisomerase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=ilvC PE=3 SV=1 | 259 | 518 | 4.0E-34 |
sp|A2RKQ6|ILVC_LACLM | Ketol-acid reductoisomerase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=ilvC PE=3 SV=1 | 264 | 582 | 4.0E-34 |
sp|B2JDN9|ILVC_BURP8 | Ketol-acid reductoisomerase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ilvC PE=3 SV=1 | 259 | 518 | 4.0E-34 |
sp|Q1GE81|ILVC_RUEST | Ketol-acid reductoisomerase OS=Ruegeria sp. (strain TM1040) GN=ilvC PE=3 SV=1 | 267 | 520 | 6.0E-34 |
sp|C3PFX1|ILVC_CORA7 | Ketol-acid reductoisomerase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=ilvC PE=3 SV=1 | 259 | 577 | 6.0E-34 |
sp|A4JGE3|ILVC_BURVG | Ketol-acid reductoisomerase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ilvC PE=3 SV=1 | 259 | 517 | 6.0E-34 |
sp|A0K937|ILVC_BURCH | Ketol-acid reductoisomerase OS=Burkholderia cenocepacia (strain HI2424) GN=ilvC PE=3 SV=1 | 259 | 517 | 6.0E-34 |
sp|B1JVQ4|ILVC_BURCC | Ketol-acid reductoisomerase OS=Burkholderia cenocepacia (strain MC0-3) GN=ilvC PE=3 SV=1 | 259 | 517 | 6.0E-34 |
sp|Q1BUZ9|ILVC_BURCA | Ketol-acid reductoisomerase OS=Burkholderia cenocepacia (strain AU 1054) GN=ilvC PE=3 SV=1 | 259 | 517 | 6.0E-34 |
sp|Q0BS26|ILVC_GRABC | Ketol-acid reductoisomerase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=ilvC PE=3 SV=1 | 259 | 578 | 6.0E-34 |
sp|B2GFJ7|ILVC_KOCRD | Ketol-acid reductoisomerase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=ilvC PE=3 SV=1 | 259 | 482 | 6.0E-34 |
sp|Q63VP6|ILVC_BURPS | Ketol-acid reductoisomerase OS=Burkholderia pseudomallei (strain K96243) GN=ilvC PE=3 SV=1 | 259 | 517 | 6.0E-34 |
sp|A3N7K4|ILVC_BURP6 | Ketol-acid reductoisomerase OS=Burkholderia pseudomallei (strain 668) GN=ilvC PE=3 SV=1 | 259 | 517 | 6.0E-34 |
sp|Q3JUC2|ILVC_BURP1 | Ketol-acid reductoisomerase OS=Burkholderia pseudomallei (strain 1710b) GN=ilvC PE=3 SV=1 | 259 | 517 | 6.0E-34 |
sp|A3NT91|ILVC_BURP0 | Ketol-acid reductoisomerase OS=Burkholderia pseudomallei (strain 1106a) GN=ilvC PE=3 SV=1 | 259 | 517 | 6.0E-34 |
sp|A1V2K2|ILVC_BURMS | Ketol-acid reductoisomerase OS=Burkholderia mallei (strain SAVP1) GN=ilvC PE=3 SV=1 | 259 | 517 | 6.0E-34 |
sp|Q62IM0|ILVC_BURMA | Ketol-acid reductoisomerase OS=Burkholderia mallei (strain ATCC 23344) GN=ilvC PE=3 SV=1 | 259 | 517 | 6.0E-34 |
sp|A2S472|ILVC_BURM9 | Ketol-acid reductoisomerase OS=Burkholderia mallei (strain NCTC 10229) GN=ilvC PE=3 SV=1 | 259 | 517 | 6.0E-34 |
sp|A3MI87|ILVC_BURM7 | Ketol-acid reductoisomerase OS=Burkholderia mallei (strain NCTC 10247) GN=ilvC PE=3 SV=1 | 259 | 517 | 6.0E-34 |
sp|B8EKP4|ILVC_METSB | Ketol-acid reductoisomerase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=ilvC PE=3 SV=1 | 259 | 518 | 7.0E-34 |
sp|B4E5N5|ILVC_BURCJ | Ketol-acid reductoisomerase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=ilvC PE=3 SV=1 | 259 | 518 | 7.0E-34 |
sp|O28294|ILVC_ARCFU | Ketol-acid reductoisomerase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=ilvC PE=3 SV=1 | 259 | 512 | 7.0E-34 |
sp|Q1R092|ILVC_CHRSD | Ketol-acid reductoisomerase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=ilvC PE=3 SV=1 | 259 | 570 | 8.0E-34 |
sp|A9AJN1|ILVC_BURM1 | Ketol-acid reductoisomerase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ilvC PE=3 SV=1 | 259 | 517 | 9.0E-34 |
sp|Q88DZ0|ILVC_PSEPK | Ketol-acid reductoisomerase OS=Pseudomonas putida (strain KT2440) GN=ilvC PE=3 SV=1 | 259 | 510 | 9.0E-34 |
sp|B0KHU2|ILVC_PSEPG | Ketol-acid reductoisomerase OS=Pseudomonas putida (strain GB-1) GN=ilvC PE=3 SV=1 | 259 | 510 | 9.0E-34 |
sp|A5W952|ILVC_PSEP1 | Ketol-acid reductoisomerase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ilvC PE=3 SV=1 | 259 | 510 | 9.0E-34 |
sp|B4RG67|ILVC_PHEZH | Ketol-acid reductoisomerase OS=Phenylobacterium zucineum (strain HLK1) GN=ilvC PE=3 SV=1 | 247 | 518 | 9.0E-34 |
sp|B1J2D7|ILVC_PSEPW | Ketol-acid reductoisomerase OS=Pseudomonas putida (strain W619) GN=ilvC PE=3 SV=1 | 259 | 510 | 1.0E-33 |
sp|Q0AGM0|ILVC_NITEC | Ketol-acid reductoisomerase OS=Nitrosomonas eutropha (strain C91) GN=ilvC PE=3 SV=1 | 271 | 518 | 1.0E-33 |
sp|B3QSP0|ILVC_CHLT3 | Ketol-acid reductoisomerase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=ilvC PE=3 SV=1 | 267 | 518 | 1.0E-33 |
sp|Q2IUS3|ILVC_RHOP2 | Ketol-acid reductoisomerase OS=Rhodopseudomonas palustris (strain HaA2) GN=ilvC PE=3 SV=1 | 259 | 521 | 1.0E-33 |
sp|Q2J6V2|ILVC_FRASC | Ketol-acid reductoisomerase OS=Frankia sp. (strain CcI3) GN=ilvC PE=3 SV=1 | 267 | 577 | 1.0E-33 |
sp|Q3SQ46|ILVC_NITWN | Ketol-acid reductoisomerase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ilvC PE=3 SV=1 | 259 | 521 | 2.0E-33 |
sp|Q9F7L6|ILVC_PRB01 | Ketol-acid reductoisomerase OS=Gamma-proteobacterium EBAC31A08 GN=ilvC PE=3 SV=1 | 259 | 517 | 2.0E-33 |
sp|B2IHY4|ILVC_BEII9 | Ketol-acid reductoisomerase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=ilvC PE=3 SV=1 | 259 | 518 | 2.0E-33 |
sp|Q139A2|ILVC_RHOPS | Ketol-acid reductoisomerase OS=Rhodopseudomonas palustris (strain BisB5) GN=ilvC PE=3 SV=1 | 259 | 521 | 3.0E-33 |
sp|C4LJH6|ILVC_CORK4 | Ketol-acid reductoisomerase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=ilvC PE=3 SV=1 | 259 | 570 | 3.0E-33 |
sp|Q8G6V1|ILVC2_BIFLO | Ketol-acid reductoisomerase 2 OS=Bifidobacterium longum (strain NCC 2705) GN=ilvC2 PE=3 SV=1 | 259 | 561 | 3.0E-33 |
sp|A4X4A5|ILVC_SALTO | Ketol-acid reductoisomerase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=ilvC PE=3 SV=1 | 259 | 517 | 4.0E-33 |
sp|Q59500|ILVC_MYCAV | Ketol-acid reductoisomerase OS=Mycobacterium avium GN=ilvC PE=3 SV=1 | 259 | 521 | 4.0E-33 |
sp|Q5LTP7|ILVC_RUEPO | Ketol-acid reductoisomerase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ilvC PE=3 SV=1 | 267 | 574 | 4.0E-33 |
sp|C0ZXM2|ILVC_RHOE4 | Ketol-acid reductoisomerase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=ilvC PE=3 SV=1 | 259 | 521 | 4.0E-33 |
sp|B0T4Y1|ILVC_CAUSK | Ketol-acid reductoisomerase OS=Caulobacter sp. (strain K31) GN=ilvC PE=3 SV=1 | 247 | 521 | 4.0E-33 |
sp|A6W7N6|ILVC_KINRD | Ketol-acid reductoisomerase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=ilvC PE=3 SV=1 | 259 | 482 | 4.0E-33 |
sp|Q73VH7|ILVC_MYCPA | Ketol-acid reductoisomerase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=ilvC PE=3 SV=2 | 259 | 521 | 5.0E-33 |
sp|A0QJC6|ILVC_MYCA1 | Ketol-acid reductoisomerase OS=Mycobacterium avium (strain 104) GN=ilvC PE=3 SV=1 | 259 | 521 | 5.0E-33 |
sp|Q6NHN2|ILVC_CORDI | Ketol-acid reductoisomerase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=ilvC PE=3 SV=1 | 259 | 518 | 5.0E-33 |
sp|A8L548|ILVC_FRASN | Ketol-acid reductoisomerase OS=Frankia sp. (strain EAN1pec) GN=ilvC PE=3 SV=1 | 267 | 577 | 5.0E-33 |
sp|Q57179|ILVC_CORGL | Ketol-acid reductoisomerase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ilvC PE=3 SV=1 | 259 | 577 | 5.0E-33 |
sp|A4QDN4|ILVC_CORGB | Ketol-acid reductoisomerase OS=Corynebacterium glutamicum (strain R) GN=ilvC PE=3 SV=1 | 259 | 577 | 5.0E-33 |
sp|A5V3W3|ILVC_SPHWW | Ketol-acid reductoisomerase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=ilvC PE=3 SV=1 | 267 | 517 | 6.0E-33 |
sp|Q211Z6|ILVC_RHOPB | Ketol-acid reductoisomerase OS=Rhodopseudomonas palustris (strain BisB18) GN=ilvC PE=3 SV=1 | 259 | 568 | 6.0E-33 |
sp|Q0BDB6|ILVC_BURCM | Ketol-acid reductoisomerase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ilvC PE=3 SV=1 | 259 | 517 | 6.0E-33 |
sp|B1YTS0|ILVC_BURA4 | Ketol-acid reductoisomerase OS=Burkholderia ambifaria (strain MC40-6) GN=ilvC PE=3 SV=1 | 259 | 517 | 6.0E-33 |
sp|Q02YY8|ILVC_LACLS | Ketol-acid reductoisomerase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=ilvC PE=3 SV=1 | 264 | 582 | 7.0E-33 |
sp|Q0S2H3|ILVC_RHOJR | Ketol-acid reductoisomerase OS=Rhodococcus jostii (strain RHA1) GN=ilvC PE=3 SV=1 | 259 | 521 | 8.0E-33 |
sp|Q5YRW2|ILVC_NOCFA | Ketol-acid reductoisomerase OS=Nocardia farcinica (strain IFM 10152) GN=ilvC PE=3 SV=1 | 259 | 541 | 8.0E-33 |
sp|B6ITR6|ILVC_RHOCS | Ketol-acid reductoisomerase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=ilvC PE=3 SV=1 | 262 | 521 | 1.0E-32 |
sp|A0QUX8|ILVC_MYCS2 | Ketol-acid reductoisomerase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ilvC PE=1 SV=1 | 259 | 541 | 1.0E-32 |
sp|B8IGT3|ILVC_METNO | Ketol-acid reductoisomerase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=ilvC PE=3 SV=1 | 259 | 518 | 1.0E-32 |
sp|Q11I83|ILVC_CHESB | Ketol-acid reductoisomerase OS=Chelativorans sp. (strain BNC1) GN=ilvC PE=3 SV=1 | 259 | 588 | 1.0E-32 |
sp|Q83HI9|ILVC_TROW8 | Ketol-acid reductoisomerase OS=Tropheryma whipplei (strain TW08/27) GN=ilvC PE=3 SV=1 | 267 | 517 | 1.0E-32 |
sp|C1B2M1|ILVC_RHOOB | Ketol-acid reductoisomerase OS=Rhodococcus opacus (strain B4) GN=ilvC PE=3 SV=1 | 259 | 521 | 2.0E-32 |
sp|A1T6Y9|ILVC_MYCVP | Ketol-acid reductoisomerase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=ilvC PE=3 SV=1 | 259 | 541 | 2.0E-32 |
sp|Q83GP6|ILVC_TROWT | Ketol-acid reductoisomerase OS=Tropheryma whipplei (strain Twist) GN=ilvC PE=3 SV=1 | 267 | 517 | 2.0E-32 |
sp|Q4FPQ6|ILVC_PELUB | Ketol-acid reductoisomerase OS=Pelagibacter ubique (strain HTCC1062) GN=ilvC PE=3 SV=1 | 259 | 510 | 2.0E-32 |
sp|O32414|ILVC_PHAMO | Ketol-acid reductoisomerase OS=Phaeospirillum molischianum GN=ilvC PE=3 SV=1 | 262 | 510 | 2.0E-32 |
sp|A1B2W3|ILVC_PARDP | Ketol-acid reductoisomerase OS=Paracoccus denitrificans (strain Pd 1222) GN=ilvC PE=3 SV=1 | 267 | 517 | 2.0E-32 |
sp|Q1BAR7|ILVC_MYCSS | Ketol-acid reductoisomerase OS=Mycobacterium sp. (strain MCS) GN=ilvC PE=3 SV=1 | 259 | 577 | 2.0E-32 |
sp|A1UE95|ILVC_MYCSK | Ketol-acid reductoisomerase OS=Mycobacterium sp. (strain KMS) GN=ilvC PE=3 SV=1 | 259 | 577 | 2.0E-32 |
sp|A3PXP9|ILVC_MYCSJ | Ketol-acid reductoisomerase OS=Mycobacterium sp. (strain JLS) GN=ilvC PE=3 SV=1 | 259 | 577 | 2.0E-32 |
sp|B5EP52|ILVC_ACIF5 | Ketol-acid reductoisomerase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=ilvC PE=3 SV=1 | 267 | 521 | 3.0E-32 |
sp|B7J643|ILVC_ACIF2 | Ketol-acid reductoisomerase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=ilvC PE=3 SV=1 | 267 | 521 | 3.0E-32 |
sp|Q6FZ98|ILVC_BARQU | Ketol-acid reductoisomerase OS=Bartonella quintana (strain Toulouse) GN=ilvC PE=3 SV=1 | 262 | 510 | 3.0E-32 |
sp|A2SHM0|ILVC_METPP | Ketol-acid reductoisomerase OS=Methylibium petroleiphilum (strain PM1) GN=ilvC PE=3 SV=1 | 259 | 517 | 3.0E-32 |
sp|A4WQ93|ILVC_RHOS5 | Ketol-acid reductoisomerase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ilvC PE=3 SV=1 | 267 | 518 | 3.0E-32 |
sp|Q6G2T6|ILVC_BARHE | Ketol-acid reductoisomerase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ilvC PE=3 SV=1 | 267 | 579 | 3.0E-32 |
sp|B9JXM6|ILVC_AGRVS | Ketol-acid reductoisomerase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=ilvC PE=3 SV=1 | 259 | 521 | 4.0E-32 |
sp|C1F6Z5|ILVC_ACIC5 | Ketol-acid reductoisomerase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=ilvC PE=3 SV=1 | 267 | 579 | 4.0E-32 |
sp|B9KM37|ILVC_RHOSK | Ketol-acid reductoisomerase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=ilvC PE=3 SV=1 | 267 | 518 | 4.0E-32 |
sp|A3PH14|ILVC_RHOS1 | Ketol-acid reductoisomerase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ilvC PE=3 SV=1 | 267 | 518 | 4.0E-32 |
sp|Q3J5C0|ILVC_RHOS4 | Ketol-acid reductoisomerase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ilvC PE=3 SV=1 | 267 | 518 | 5.0E-32 |
sp|A8M5F9|ILVC_SALAI | Ketol-acid reductoisomerase OS=Salinispora arenicola (strain CNS-205) GN=ilvC PE=3 SV=1 | 259 | 517 | 5.0E-32 |
sp|O25097|ILVC_HELPY | Ketol-acid reductoisomerase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ilvC PE=3 SV=1 | 267 | 576 | 5.0E-32 |
sp|Q4JUN9|ILVC_CORJK | Ketol-acid reductoisomerase OS=Corynebacterium jeikeium (strain K411) GN=ilvC PE=3 SV=1 | 259 | 541 | 5.0E-32 |
sp|A5UMJ9|ILVC_METS3 | Ketol-acid reductoisomerase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=ilvC PE=3 SV=1 | 247 | 562 | 5.0E-32 |
sp|B8HAS8|ILVC_ARTCA | Ketol-acid reductoisomerase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=ilvC PE=3 SV=1 | 259 | 577 | 5.0E-32 |
sp|Q18GT4|ILVC_HALWD | Ketol-acid reductoisomerase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=ilvC PE=3 SV=3 | 260 | 512 | 5.0E-32 |
sp|B9JGH5|ILVC_AGRRK | Ketol-acid reductoisomerase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=ilvC PE=3 SV=1 | 259 | 518 | 7.0E-32 |
sp|B5ZVQ5|ILVC_RHILW | Ketol-acid reductoisomerase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=ilvC PE=3 SV=1 | 259 | 588 | 8.0E-32 |
sp|Q21T70|ILVC_RHOFT | Ketol-acid reductoisomerase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ilvC PE=3 SV=1 | 259 | 518 | 1.0E-31 |
sp|A0PPY3|ILVC_MYCUA | Ketol-acid reductoisomerase OS=Mycobacterium ulcerans (strain Agy99) GN=ilvC PE=3 SV=1 | 259 | 521 | 1.0E-31 |
sp|B1XYB1|ILVC_LEPCP | Ketol-acid reductoisomerase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=ilvC PE=3 SV=1 | 259 | 521 | 1.0E-31 |
sp|Q2RX71|ILVC_RHORT | Ketol-acid reductoisomerase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=ilvC PE=3 SV=1 | 262 | 570 | 1.0E-31 |
sp|B1VG26|ILVC_CORU7 | Ketol-acid reductoisomerase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=ilvC PE=3 SV=1 | 259 | 577 | 1.0E-31 |
sp|A8LS39|ILVC_DINSH | Ketol-acid reductoisomerase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=ilvC PE=3 SV=1 | 267 | 517 | 1.0E-31 |
sp|Q2K6M2|ILVC_RHIEC | Ketol-acid reductoisomerase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ilvC PE=3 SV=1 | 259 | 518 | 1.0E-31 |
sp|B3PT89|ILVC_RHIE6 | Ketol-acid reductoisomerase OS=Rhizobium etli (strain CIAT 652) GN=ilvC PE=3 SV=1 | 259 | 518 | 1.0E-31 |
sp|Q9A6H4|ILVC_CAUCR | Ketol-acid reductoisomerase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=ilvC PE=3 SV=1 | 247 | 570 | 1.0E-31 |
sp|B8GXW2|ILVC_CAUCN | Ketol-acid reductoisomerase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=ilvC PE=3 SV=1 | 247 | 570 | 1.0E-31 |
sp|B1VZ72|ILVC_STRGG | Ketol-acid reductoisomerase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=ilvC PE=3 SV=1 | 259 | 561 | 2.0E-31 |
sp|A4TE07|ILVC_MYCGI | Ketol-acid reductoisomerase OS=Mycobacterium gilvum (strain PYR-GCK) GN=ilvC PE=3 SV=1 | 259 | 541 | 2.0E-31 |
sp|Q168N1|ILVC_ROSDO | Ketol-acid reductoisomerase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ilvC PE=3 SV=1 | 267 | 517 | 3.0E-31 |
sp|A0JXZ6|ILVC_ARTS2 | Ketol-acid reductoisomerase OS=Arthrobacter sp. (strain FB24) GN=ilvC PE=3 SV=1 | 259 | 544 | 3.0E-31 |
sp|Q2W1G2|ILVC_MAGSA | Ketol-acid reductoisomerase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=ilvC PE=3 SV=2 | 262 | 518 | 4.0E-31 |
sp|Q9ZMA9|ILVC_HELPJ | Ketol-acid reductoisomerase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ilvC PE=3 SV=1 | 267 | 576 | 4.0E-31 |
sp|P9WKJ7|ILVC_MYCTU | Ketol-acid reductoisomerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvC PE=1 SV=2 | 259 | 521 | 4.0E-31 |
sp|P9WKJ6|ILVC_MYCTO | Ketol-acid reductoisomerase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ilvC PE=3 SV=2 | 259 | 521 | 4.0E-31 |
sp|O82043|ILV5_PEA | Ketol-acid reductoisomerase, chloroplastic OS=Pisum sativum GN=PGAAIR PE=2 SV=1 | 456 | 522 | 6.0E-12 |
sp|Q01292|ILV5_SPIOL | Ketol-acid reductoisomerase, chloroplastic OS=Spinacia oleracea GN=AHRI PE=1 SV=1 | 457 | 527 | 8.0E-12 |
sp|Q05758|ILV5_ARATH | Ketol-acid reductoisomerase, chloroplastic OS=Arabidopsis thaliana GN=At3g58610 PE=2 SV=2 | 457 | 522 | 2.0E-11 |
sp|Q65XK0|ILV5_ORYSJ | Ketol-acid reductoisomerase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os05g0573700 PE=1 SV=1 | 456 | 522 | 3.0E-11 |
GO Term | Description | Terminal node |
---|---|---|
GO:0009082 | branched-chain amino acid biosynthetic process | Yes |
GO:0004455 | ketol-acid reductoisomerase activity | Yes |
GO:0044249 | cellular biosynthetic process | No |
GO:0044237 | cellular metabolic process | No |
GO:0044238 | primary metabolic process | No |
GO:0003824 | catalytic activity | No |
GO:0009987 | cellular process | No |
GO:0009058 | biosynthetic process | No |
GO:0008152 | metabolic process | No |
GO:0019752 | carboxylic acid metabolic process | No |
GO:0043436 | oxoacid metabolic process | No |
GO:0044283 | small molecule biosynthetic process | No |
GO:1901576 | organic substance biosynthetic process | No |
GO:0006082 | organic acid metabolic process | No |
GO:0016616 | oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor | No |
GO:0003674 | molecular_function | No |
GO:0006520 | cellular amino acid metabolic process | No |
GO:0016614 | oxidoreductase activity, acting on CH-OH group of donors | No |
GO:1901564 | organonitrogen compound metabolic process | No |
GO:1901566 | organonitrogen compound biosynthetic process | No |
GO:0008150 | biological_process | No |
GO:0016491 | oxidoreductase activity | No |
GO:0044281 | small molecule metabolic process | No |
GO:0071704 | organic substance metabolic process | No |
GO:0009081 | branched-chain amino acid metabolic process | No |
GO:0006807 | nitrogen compound metabolic process | No |
GO:0016053 | organic acid biosynthetic process | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 31 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Ophun1|1031 MRKIWSMKKEQKQAENAEGQAAGGKKKKVTAAQLRVQKDLSELSLGTTMKTDFPDADDILNFVLTIEPDEGMYRG GRFSFDFAINQNFPHEPPKVRCKQVIYHPNIDLEGKVCLNILREDWKPVLNLNAVIVGLQFLFLEPNASDPLNKE AAEDLRHNREAFKRNVRTAMGGGSVKGTTFDRVVIRLSKALRVPTARQLASPRLVRPISSLVAGRGLLRASATTA VRPMVQTRGKKTINFAGVKEDVWERSDWSVERLLEYFRGDTLALIGYGSQGHGQGLNLRDNGLNVIVGVRPGGKS WKDAVQDGWQPGKNLMDIDEAISKGTIIMNLLSDAAQSETWPAIKPQLTKDKTLYFSHGFSPVFKDLTKVDVPKN IDVILVAPKGSGRTVRSLFREGRGINSSYAVFQDVSGIAEEKAIALGVAIGSGYLYKTTFQKEVYSDLYGERGCL MGGIHGMFLAQYEVLRQRGHSPSEAFNETVEEATQSLYPLIGANGMDWMFEACSTTARRGAIDWTPKFKKALLPV FNELYDSVVDGTETKRSLEYNSQKDYRQQYEQEMQDIKNMEIWQAGKAVRSLRPENQGQHIEEDDD* |
Coding | >Ophun1|1031 ATGCGAAAGATATGGTCCATGAAAAAGGAGCAGAAGCAGGCGGAGAATGCAGAAGGACAAGCGGCGGGGGGCAAG AAGAAGAAGGTGACGGCGGCGCAGCTGCGGGTGCAGAAAGATCTTTCGGAGCTGTCGCTGGGTACGACGATGAAG ACGGACTTTCCCGACGCAGACGACATCCTCAACTTTGTGCTTACCATTGAGCCGGACGAGGGCATGTACCGGGGC GGGCGCTTCAGCTTCGACTTTGCCATCAACCAAAACTTCCCGCACGAGCCGCCCAAGGTGCGGTGCAAGCAGGTC ATCTACCACCCCAACATTGACCTGGAGGGCAAAGTGTGCCTGAACATTCTGCGCGAGGACTGGAAGCCGGTGCTG AACCTCAATGCCGTCATTGTCGGTCTGCAGTTCCTCTTCCTCGAACCCAATGCTTCGGACCCGCTCAACAAGGAG GCAGCCGAGGACCTGCGGCACAACCGCGAGGCGTTTAAGCGCAATGTGCGGACGGCAATGGGCGGGGGCTCTGTC AAGGGGACGACGTTTGACCGAGTTGTTATACGTCTTTCCAAGGCGCTGCGTGTGCCGACGGCCCGCCAATTGGCC TCGCCGCGCCTCGTCCGGCCCATTTCAAGCCTCGTGGCCGGTCGCGGCCTGTTACGGGCTTCTGCCACGACTGCT GTCCGACCGATGGTGCAGACGCGTGGGAAGAAGACGATCAACTTTGCCGGCGTCAAGGAGGATGTTTGGGAGCGT TCCGACTGGTCTGTGGAGAGGCTCCTGGAATACTTTAGGGGCGACACGCTGGCCCTCATCGGCTACGGCTCCCAG GGCCACGGCCAGGGCCTCAACCTCCGCGACAATGGCCTCAACGTCATCGTCGGCGTTCGCCCCGGTGGCAAGTCG TGGAAAGACGCTGTTCAGGACGGCTGGCAGCCCGGAAAGAATCTGATGGACATCGATGAAGCCATCTCCAAGGGA ACCATCATCATGAACCTGCTCAGCGACGCCGCCCAATCGGAGACGTGGCCGGCCATCAAGCCGCAGCTCACCAAG GACAAGACGCTGTACTTCTCTCACGGCTTCTCGCCCGTCTTCAAGGACCTGACCAAGGTCGACGTGCCCAAAAAC ATTGACGTCATTCTCGTCGCGCCCAAGGGCTCCGGACGGACTGTTCGTTCTCTCTTCCGCGAGGGCCGTGGCATC AACTCGTCCTATGCCGTCTTCCAGGACGTCAGTGGCATAGCCGAGGAAAAGGCCATCGCGCTCGGCGTGGCCATC GGATCTGGCTACCTGTACAAGACGACCTTCCAGAAGGAGGTCTACTCGGATCTGTACGGCGAGCGCGGCTGCTTG ATGGGCGGCATCCACGGCATGTTCCTGGCTCAGTACGAGGTCCTCCGCCAGCGCGGCCACAGCCCGAGCGAGGCC TTTAACGAGACGGTCGAGGAGGCGACGCAGAGCCTTTACCCCCTCATCGGGGCCAACGGCATGGACTGGATGTTC GAGGCCTGCTCGACGACGGCCCGACGCGGCGCCATCGACTGGACGCCCAAGTTCAAGAAGGCCCTGTTGCCCGTC TTCAATGAGTTGTACGACAGCGTCGTGGACGGCACCGAGACGAAGCGGTCGCTCGAGTACAACAGCCAGAAGGAC TACCGGCAGCAGTATGAGCAGGAGATGCAGGATATCAAAAACATGGAGATTTGGCAGGCCGGCAAGGCCGTGCGA TCGTTGCGACCTGAGAACCAGGGCCAGCATATTGAGGAAGATGATGATTGA |
Transcript | >Ophun1|1031 ATGCGAAAGATATGGTCCATGAAAAAGGAGCAGAAGCAGGCGGAGAATGCAGAAGGACAAGCGGCGGGGGGCAAG AAGAAGAAGGTGACGGCGGCGCAGCTGCGGGTGCAGAAAGATCTTTCGGAGCTGTCGCTGGGTACGACGATGAAG ACGGACTTTCCCGACGCAGACGACATCCTCAACTTTGTGCTTACCATTGAGCCGGACGAGGGCATGTACCGGGGC GGGCGCTTCAGCTTCGACTTTGCCATCAACCAAAACTTCCCGCACGAGCCGCCCAAGGTGCGGTGCAAGCAGGTC ATCTACCACCCCAACATTGACCTGGAGGGCAAAGTGTGCCTGAACATTCTGCGCGAGGACTGGAAGCCGGTGCTG AACCTCAATGCCGTCATTGTCGGTCTGCAGTTCCTCTTCCTCGAACCCAATGCTTCGGACCCGCTCAACAAGGAG GCAGCCGAGGACCTGCGGCACAACCGCGAGGCGTTTAAGCGCAATGTGCGGACGGCAATGGGCGGGGGCTCTGTC AAGGGGACGACGTTTGACCGAGTTGTTATACGTCTTTCCAAGGCGCTGCGTGTGCCGACGGCCCGCCAATTGGCC TCGCCGCGCCTCGTCCGGCCCATTTCAAGCCTCGTGGCCGGTCGCGGCCTGTTACGGGCTTCTGCCACGACTGCT GTCCGACCGATGGTGCAGACGCGTGGGAAGAAGACGATCAACTTTGCCGGCGTCAAGGAGGATGTTTGGGAGCGT TCCGACTGGTCTGTGGAGAGGCTCCTGGAATACTTTAGGGGCGACACGCTGGCCCTCATCGGCTACGGCTCCCAG GGCCACGGCCAGGGCCTCAACCTCCGCGACAATGGCCTCAACGTCATCGTCGGCGTTCGCCCCGGTGGCAAGTCG TGGAAAGACGCTGTTCAGGACGGCTGGCAGCCCGGAAAGAATCTGATGGACATCGATGAAGCCATCTCCAAGGGA ACCATCATCATGAACCTGCTCAGCGACGCCGCCCAATCGGAGACGTGGCCGGCCATCAAGCCGCAGCTCACCAAG GACAAGACGCTGTACTTCTCTCACGGCTTCTCGCCCGTCTTCAAGGACCTGACCAAGGTCGACGTGCCCAAAAAC ATTGACGTCATTCTCGTCGCGCCCAAGGGCTCCGGACGGACTGTTCGTTCTCTCTTCCGCGAGGGCCGTGGCATC AACTCGTCCTATGCCGTCTTCCAGGACGTCAGTGGCATAGCCGAGGAAAAGGCCATCGCGCTCGGCGTGGCCATC GGATCTGGCTACCTGTACAAGACGACCTTCCAGAAGGAGGTCTACTCGGATCTGTACGGCGAGCGCGGCTGCTTG ATGGGCGGCATCCACGGCATGTTCCTGGCTCAGTACGAGGTCCTCCGCCAGCGCGGCCACAGCCCGAGCGAGGCC TTTAACGAGACGGTCGAGGAGGCGACGCAGAGCCTTTACCCCCTCATCGGGGCCAACGGCATGGACTGGATGTTC GAGGCCTGCTCGACGACGGCCCGACGCGGCGCCATCGACTGGACGCCCAAGTTCAAGAAGGCCCTGTTGCCCGTC TTCAATGAGTTGTACGACAGCGTCGTGGACGGCACCGAGACGAAGCGGTCGCTCGAGTACAACAGCCAGAAGGAC TACCGGCAGCAGTATGAGCAGGAGATGCAGGATATCAAAAACATGGAGATTTGGCAGGCCGGCAAGGCCGTGCGA TCGTTGCGACCTGAGAACCAGGGCCAGCATATTGAGGAAGATGATGATTGA |
Gene | >Ophun1|1031 ATGCGAAAGATATGGTCCATGGTACGTCACGAAATGGTCGACGGAAGCCGTGGCGCCAGGCTGACTGGGAGCAGA AAAAGGAGCAGAAGCAGGCGGAGAATGCAGAAGGACAAGCGGCGGGGGGCAAGAAGAAGAAGGTGACGGCGGCGC AGCTGCGGGTGCAGAAAGGTGGGCGGAATCTAGGGAAGAGGAAGAGACGGCGAGGGAGAGACTGACGGGGGGAAC AGATCTTTCGGAGCTGTCGCTGGGTACGACGATGAAGACGGACTTTCCCGACGCAGACGACATCCTCAACTTTGT GCTTACCATTGAGCCGGACGAGGGCATGTACCGGGGCGGGCGCTTCAGCTTCGACTTTGCCATCAACCAAAACTT CCCGCACGAGCCGCCCAAGGTGCGGTGCAAGCAGGTCATCTACCACCCCAACATTGACCTGGAGGGCAAAGTGTG CCTGAACATTCTGCGCGAGGACTGGAAGCCGGTGCTGAACCTCAATGCCGTCATTGTCGGTCTGCAGGTGAGTAG CATCGCCGGGGGTTTCTTTCAGAGACGCTGACCGGGCAGTTCCTCTTCCTCGAACCCAATGCTTCGGACCCGCTC AACAAGGAGGCAGCCGAGGACCTGCGGCACAACCGCGAGGCGTTTAAGCGCAATGTGCGGACGGCAATGGGCGGG GGCTCTGTCAAGGGGACGACGTTTGACCGAGTTGTTATACGGTAGCGGCATTCGCAGGGAGGCAGATGATGGAAG GATGGATGGATGGACGGATGATGGGTGGTGAATGGGATGGTGCGGAAGAGCGTTGTGACTCTGTTTTTATGAGTA TCTAGGTGGCCATTGCGGCTGCTCTACATACTCGAGCCGTTTTCACTATTTCTACCATTGCATCCGTAACAAGTA TCTGTTTGTCTCTGTGTTCGTCGACTGCGTTCGTCGTCTGTAGTAGTAATACGAGTGTCGATGCTTGGGTGAGCA GGCAGCGCGACATCGGCGCCTCGACCCACTTGGCCCCGACATCGGAATCGTCAGCCACGGCGCCAGGAACAATTT TGCACCTTCGTTTCCGGACCCTCCAGCATAAAGACAGTCCATTGCCTACCGTCTCAGCCATCTTCTTGACCACTG TCTCCCCTGAATTCAGAGAGAAAAGCTGCCGATGGCGTCGAAAAGTCTTTCCAAGGCGCTGCGTGTGCCGACGGC CCGCCAATTGGCCTCGCCGCGCCTCGTCCGGCCCATTTCAAGCCTCGTGGCCGGTCGCGGCCTGTTACGGGCTTC TGCCACGACTGCTGTCCGACCGATGGTGCAGACGCGTGGGAAGAAGACGATCAACTTTGCCGGCGTCAAGGAGGA TGTTTGGGGTATGGGTTTGGCCTTTTGGGGTGTTGGATGGGCTGGGCTGACTTTGCTGGTGTAGAGCGTTCCGAC TGGTCTGTGGAGAGGCTCCTGGTGAGTTGCGACGCCTCTTTTTCTTTCCAAGTGTTCTGACGTGGGATCTGCAGG AATACTTTAGGGGCGACACGCTGGCCCTCATCGGCTACGGCTCCCAGGGCCACGGCCAGGGCCTCAACCTCCGCG ACAATGGCCTCAACGTCATCGTCGGCGTTCGCCCCGGTGGCAAGTCGTGGAAAGACGCTGTTCAGGACGGCTGGC AGCCCGGAAAGAATCTGATGGACATCGATGAAGCCATCTCCAAGGGAACCATCATCATGAACCTGCTCAGCGACG CCGCCCAATCGGAGACGTGGCCGGCCATCAAGCCGCAGCTCACCAAGGACAAGGTGAGCATCTACTCCTCTTTAT CATGTCTGAGACGGCGACGCTGATGACGATAGACGCTGTACTTCTCTCACGGCTTCTCGCCCGTCTTCAAGGACC TGACCAAGGTCGACGTGCCCAAAAACATTGACGTCATTCTCGTCGCGCCCAAGGGCTCCGGACGGACTGTTCGTT CTCTCTTCCGCGAGGGCCGTGGCATCAACTCGTCCTATGCCGTCTTCCAGGACGTCAGTGGCATAGCCGAGGAAA AGGCCATCGCGCTCGGCGTGGCCATCGGATCTGGCTACCTGTACAAGACGACCTTCCAGAAGGAGGTCTACTCGG ATCTGTACGGCGAGCGCGGCTGCTTGATGGGCGGCATCCACGGCATGTTCCTGGCTCAGTACGAGGTCCTCCGCC AGCGCGGCCACAGCCCGAGCGAGGCCTTTAACGAGACGGTCGAGGAGGCGACGCAGAGCCTTTACCCCCTCATCG GGGCCAACGGCATGGACTGGATGTTCGAGGCCTGCTCGACGACGGCCCGACGCGGCGCCATCGACTGGACGCCCA AGTTCAAGAAGGCCCTGTTGCCCGTCTTCAATGAGTTGTACGACAGCGTCGTGGACGGCACCGAGACGAAGCGGT CGCTCGAGTACAACAGCCAGAAGGACTACCGGCAGCAGTATGAGCAGGAGATGCAGGATATCAAAAACATGGAGA TTTGGCAGGCCGGCAAGGCCGTGCGGTACGTGTGACCCGACCAAAGCCGGAACGTTGCGTTGGGCTGACTTGTTT GGGCACAGATCGTTGCGACCTGAGAACCAGGGCCAGCATATTGAGGAAGATGATGATTGA |