Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1014
Gene name
LocationContig_138:11319..13272
Strand+
Gene length (bp)1953
Transcript length (bp)1686
Coding sequence length (bp)1686
Protein length (aa) 562

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 7.5E-87 63 519
PF07690 MFS_1 Major Facilitator Superfamily 2.6E-10 114 440

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38156|MAL31_YEAST Maltose permease MAL31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL31 PE=1 SV=1 3 547 1.0E-142
sp|P15685|MAL61_YEASX Maltose permease MAL61 OS=Saccharomyces cerevisiae GN=MAL61 PE=3 SV=1 3 547 9.0E-142
sp|P53048|MAL11_YEAST General alpha-glucoside permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL11 PE=1 SV=1 3 542 5.0E-140
sp|B5VF36|MPH3_YEAS6 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MPH3 PE=3 SV=1 24 536 1.0E-136
sp|P0CD99|MPH2_YEAST Alpha-glucosides permease MPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH2 PE=2 SV=1 24 536 1.0E-136
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38156|MAL31_YEAST Maltose permease MAL31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL31 PE=1 SV=1 3 547 1.0E-142
sp|P15685|MAL61_YEASX Maltose permease MAL61 OS=Saccharomyces cerevisiae GN=MAL61 PE=3 SV=1 3 547 9.0E-142
sp|P53048|MAL11_YEAST General alpha-glucoside permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL11 PE=1 SV=1 3 542 5.0E-140
sp|B5VF36|MPH3_YEAS6 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MPH3 PE=3 SV=1 24 536 1.0E-136
sp|P0CD99|MPH2_YEAST Alpha-glucosides permease MPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH2 PE=2 SV=1 24 536 1.0E-136
sp|P0CE00|MPH3_YEAST Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH3 PE=1 SV=1 24 536 1.0E-136
sp|A6ZX88|MPH3_YEAS7 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MPH3 PE=3 SV=1 24 536 1.0E-136
sp|C8Z6M6|MPH3_YEAS8 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MPH3 PE=3 SV=1 24 536 2.0E-136
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 15 530 2.0E-27
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 53 523 2.0E-27
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 15 530 2.0E-27
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 55 527 4.0E-27
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 73 523 4.0E-26
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 56 530 8.0E-26
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 73 523 1.0E-25
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 73 523 1.0E-25
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 65 530 4.0E-25
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 73 538 5.0E-25
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 165 558 8.0E-24
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 15 530 2.0E-23
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 65 530 2.0E-23
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 62 519 2.0E-23
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 15 530 3.0E-23
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 54 538 6.0E-23
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 71 519 7.0E-23
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 71 519 8.0E-23
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 118 517 9.0E-23
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 63 519 1.0E-22
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 73 521 8.0E-22
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 71 523 1.0E-21
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 66 547 1.0E-21
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 71 530 3.0E-21
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 70 525 3.0E-21
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 71 530 3.0E-21
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 70 520 4.0E-21
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 73 519 5.0E-21
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 71 519 8.0E-21
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 73 545 3.0E-20
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 71 523 6.0E-20
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 71 516 8.0E-20
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 71 530 1.0E-19
sp|Q9P3U6|GHT1_SCHPO High-affinity glucose transporter ght1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght1 PE=1 SV=1 63 519 2.0E-19
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 117 520 2.0E-19
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 46 558 2.0E-19
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 116 524 2.0E-19
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 58 528 2.0E-19
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 129 543 3.0E-19
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 165 522 3.0E-19
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 165 522 3.0E-19
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 165 558 5.0E-19
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 71 530 5.0E-19
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 63 523 5.0E-19
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 165 543 5.0E-19
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 46 558 8.0E-19
sp|Q5R608|GTR3_PONAB Solute carrier family 2, facilitated glucose transporter member 3 OS=Pongo abelii GN=SLC2A3 PE=2 SV=1 117 522 8.0E-19
sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1 117 522 1.0E-18
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 117 516 2.0E-18
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 66 522 3.0E-18
sp|Q8L6Z8|XYLL1_ARATH D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1 101 516 6.0E-18
sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus GN=SLC2A3 PE=2 SV=1 116 522 8.0E-18
sp|Q4U3U6|QAY_NEUAF Quinate permease OS=Neurospora africana GN=qa-y PE=3 SV=1 46 558 8.0E-18
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 114 516 1.0E-17
sp|P17809|GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus GN=Slc2a1 PE=1 SV=4 73 537 1.0E-17
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 73 519 1.0E-17
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 117 534 2.0E-17
sp|P27674|GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus GN=SLC2A1 PE=1 SV=1 90 537 5.0E-17
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 165 550 5.0E-17
sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2 117 537 5.0E-17
sp|P11167|GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus GN=Slc2a1 PE=1 SV=1 73 537 6.0E-17
sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14 PE=2 SV=1 116 522 6.0E-17
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 73 538 1.0E-16
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 58 520 2.0E-16
sp|P13355|GTR1_RABIT Solute carrier family 2, facilitated glucose transporter member 1 OS=Oryctolagus cuniculus GN=SLC2A1 PE=2 SV=1 117 537 2.0E-16
sp|P20303|GTR1_PIG Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa GN=SLC2A1 PE=2 SV=2 90 537 3.0E-16
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 73 533 4.0E-16
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 73 522 5.0E-16
sp|Q90592|GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus GN=SLC2A2 PE=2 SV=1 117 522 5.0E-16
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 73 525 5.0E-16
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 58 521 7.0E-16
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 73 522 1.0E-15
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 87 519 2.0E-15
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 73 408 2.0E-15
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 106 522 6.0E-15
sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1 107 544 6.0E-15
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 113 516 9.0E-15
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 58 534 1.0E-14
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 68 530 1.0E-14
sp|P0C6A1|GTR7_MOUSE Solute carrier family 2, facilitated glucose transporter member 7 OS=Mus musculus GN=Slc2a7 PE=3 SV=1 53 522 4.0E-14
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 185 530 4.0E-14
sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2 73 525 6.0E-14
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 58 527 7.0E-14
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2 118 517 1.0E-13
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 117 516 1.0E-13
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus GN=Slc2a3 PE=1 SV=1 117 541 3.0E-13
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 16 520 7.0E-13
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 73 519 7.0E-13
sp|Q9U539|OCT1_CAEEL Organic cation transporter 1 OS=Caenorhabditis elegans GN=oct-1 PE=1 SV=3 106 381 7.0E-13
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 126 333 8.0E-13
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 116 516 1.0E-12
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 73 522 1.0E-12
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 120 519 1.0E-12
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 105 401 2.0E-12
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 95 516 2.0E-12
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 95 516 2.0E-12
sp|P79365|GTR1_SHEEP Solute carrier family 2, facilitated glucose transporter member 1 (Fragment) OS=Ovis aries GN=SLC2A1 PE=2 SV=1 160 537 3.0E-12
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 117 524 3.0E-12
sp|Q8IRI6|GTR1_DROME Glucose transporter type 1 OS=Drosophila melanogaster GN=Glut1 PE=2 SV=4 129 519 3.0E-12
sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 117 516 4.0E-12
sp|O44616|FGTH1_CAEEL Facilitated glucose transporter homolog OS=Caenorhabditis elegans GN=R09B5.11 PE=1 SV=2 92 392 6.0E-12
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 96 517 7.0E-12
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 105 401 7.0E-12
sp|P19357|GTR4_RAT Solute carrier family 2, facilitated glucose transporter member 4 OS=Rattus norvegicus GN=Slc2a4 PE=1 SV=1 117 524 8.0E-12
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 116 541 9.0E-12
sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 111 516 1.0E-11
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus GN=Slc2a5 PE=1 SV=1 73 522 2.0E-11
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 96 516 2.0E-11
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 73 519 3.0E-11
sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1 118 517 3.0E-11
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 111 520 4.0E-11
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus GN=Slc2a5 PE=1 SV=2 156 522 9.0E-11
sp|P14142|GTR4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus GN=Slc2a4 PE=1 SV=3 117 524 1.0E-10
sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2 160 522 1.0E-10
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 102 279 2.0E-10
sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose transporter member 7 OS=Rattus norvegicus GN=Slc2a7 PE=2 SV=1 160 522 5.0E-10
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 118 522 5.0E-10
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 115 531 6.0E-10
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 115 531 6.0E-10
sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL040W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL040W PE=1 SV=1 101 520 7.0E-10
sp|Q27994|GTR4_BOVIN Solute carrier family 2, facilitated glucose transporter member 4 OS=Bos taurus GN=SLC2A4 PE=2 SV=2 117 524 7.0E-10
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 116 516 8.0E-10
sp|P58351|GTR2_BOVIN Solute carrier family 2, facilitated glucose transporter member 2 OS=Bos taurus GN=SLC2A2 PE=2 SV=2 107 445 8.0E-10
sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 117 523 1.0E-09
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 99 397 2.0E-09
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 95 346 3.0E-09
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 73 516 4.0E-09
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 130 398 9.0E-09
sp|P14672|GTR4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens GN=SLC2A4 PE=1 SV=1 117 524 1.0E-08
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 118 398 1.0E-08
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 131 516 2.0E-08
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 131 516 2.0E-08
sp|P21906|GLF_ZYMMO Glucose facilitated diffusion protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glf PE=3 SV=2 122 516 2.0E-08
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 111 403 3.0E-08
sp|Q8VZT3|EDL12_ARATH Sugar transporter ERD6-like 12 OS=Arabidopsis thaliana GN=SUGTL5 PE=2 SV=1 118 519 3.0E-08
sp|Q9M0Z9|EDL15_ARATH Sugar transporter ERD6-like 15 OS=Arabidopsis thaliana GN=At4g04760 PE=3 SV=2 117 519 3.0E-08
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 62 387 3.0E-08
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 131 516 3.0E-08
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 115 519 4.0E-08
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 95 346 6.0E-08
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 95 346 6.0E-08
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 128 518 6.0E-08
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 131 516 7.0E-08
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 129 398 7.0E-08
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 9 403 8.0E-08
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 131 516 9.0E-08
sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT14 PE=1 SV=2 162 520 9.0E-08
sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 63 516 9.0E-08
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 126 271 1.0E-07
sp|Q5J316|GTR12_BOVIN Solute carrier family 2, facilitated glucose transporter member 12 OS=Bos taurus GN=SLC2A12 PE=1 SV=1 117 403 1.0E-07
sp|Q9BYW1|GTR11_HUMAN Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens GN=SLC2A11 PE=2 SV=1 73 533 1.0E-07
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 62 522 2.0E-07
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 157 522 2.0E-07
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 131 516 2.0E-07
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 107 517 2.0E-07
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 120 516 3.0E-07
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 102 406 4.0E-07
sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 34 518 4.0E-07
sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 115 519 4.0E-07
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 111 278 4.0E-07
sp|P38055|YDJE_ECOLI Inner membrane metabolite transport protein YdjE OS=Escherichia coli (strain K12) GN=ydjE PE=1 SV=2 105 495 4.0E-07
sp|Q5RET7|GTR5_PONAB Solute carrier family 2, facilitated glucose transporter member 5 OS=Pongo abelii GN=SLC2A5 PE=2 SV=1 73 521 5.0E-07
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 118 284 7.0E-07
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 38 290 8.0E-07
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 103 407 8.0E-07
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 131 516 8.0E-07
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 63 387 9.0E-07
sp|Q8HY24|S22A8_RABIT Solute carrier family 22 member 8 OS=Oryctolagus cuniculus GN=SLC22A8 PE=2 SV=1 118 325 1.0E-06
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 131 516 1.0E-06
sp|Q9LTP6|EDL13_ARATH Putative sugar transporter ERD6-like 13 OS=Arabidopsis thaliana GN=At3g20460 PE=3 SV=2 117 516 1.0E-06
sp|Q6NWF1|GTR12_DANRE Solute carrier family 2, facilitated glucose transporter member 12 OS=Danio rerio GN=slc2a12 PE=2 SV=2 131 366 1.0E-06
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 105 516 1.0E-06
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 70 518 2.0E-06
sp|Q8VC69|S22A6_MOUSE Solute carrier family 22 member 6 OS=Mus musculus GN=Slc22a6 PE=1 SV=1 117 316 2.0E-06
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 120 281 2.0E-06
sp|Q9SCW7|ERDL1_ARATH Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2 23 521 2.0E-06
sp|O35956|S22A6_RAT Solute carrier family 22 member 6 OS=Rattus norvegicus GN=Slc22a6 PE=1 SV=1 117 316 3.0E-06
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 131 516 4.0E-06
sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 131 516 5.0E-06
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 53 280 5.0E-06
sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 131 516 5.0E-06
sp|A6QLW8|S22A7_BOVIN Solute carrier family 22 member 7 OS=Bos taurus GN=SLC22A7 PE=2 SV=1 118 322 6.0E-06
sp|Q5EXK5|MHBT_KLEOX 3-hydroxybenzoate transporter MhbT OS=Klebsiella oxytoca GN=mhbT PE=1 SV=1 127 287 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 133 155 22
2 162 184 22
3 234 256 22
4 382 404 22
5 419 439 20
6 452 474 22
7 484 502 18

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup38
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1473
Ophiocordyceps australis 1348a (Ghana) OphauG2|683
Ophiocordyceps australis map64 (Brazil) OphauB2|1286
Ophiocordyceps australis map64 (Brazil) OphauB2|1397
Ophiocordyceps australis map64 (Brazil) OphauB2|5418
Ophiocordyceps camponoti-floridani Ophcf2|02934
Ophiocordyceps camponoti-floridani Ophcf2|06980
Ophiocordyceps camponoti-floridani Ophcf2|01832
Ophiocordyceps camponoti-floridani Ophcf2|02979
Ophiocordyceps camponoti-rufipedis Ophun1|1180
Ophiocordyceps camponoti-rufipedis Ophun1|1014 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7258
Ophiocordyceps camponoti-rufipedis Ophun1|2999
Ophiocordyceps kimflemingae Ophio5|1441
Ophiocordyceps kimflemingae Ophio5|3660
Ophiocordyceps kimflemingae Ophio5|7252
Ophiocordyceps kimflemingae Ophio5|8525
Ophiocordyceps subramaniannii Hirsu2|9948
Ophiocordyceps subramaniannii Hirsu2|6805
Ophiocordyceps subramaniannii Hirsu2|1776
Ophiocordyceps subramaniannii Hirsu2|10985

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1014
MALTTFEFVPRPAASEDHDIKGVDSARLRRTVVDNARAAASKERSMTLLQGLRLYPKAVAWSLLISTCIVMEGYD
ISLVNNFYAFPQFKRKYGEPLKDGTYEIPAAWQAGLSNGAQVGEIIGLFINGFVSERFGYRYTVLACLALVTAFT
AVFFTAPNVQTLLVAEILCGIPWGIFQTLTVTYASEVCPIALRGYLTTYVNFCWGLGQEIGIGVIRSMLHRNDEW
SYRIPYALQWMWPVPLFVGVCFAPESPWWLVRRGRIEEAKRSLLRLTSPDRETDFDADETVAMMVHTTALEEKMT
KGATYWDCFKGTDLRRTEIVCMTWAIQNLSGNSFSNYSTYFLKQAGLPEETSYSFALGQYAINMVGVFGAWGLMT
MGAGRRSLYLYGLCGLCAMLFILGFLGLVPERQRPMASMATGSIMILWALIYQLTVGTVCYSLVSELSSRRLQIK
TVVLGRNLYNVVGIITGVLTPYMLNPGAWNWRNFTGFFWAGICFLCIVYTYFRLPEPKGRTFAELDVLFDQRVSA
RKFASTEVDVFHETLEETVVSEYEAVFDSRPAVEKT*
Coding >Ophun1|1014
ATGGCTCTCACCACGTTCGAGTTCGTTCCGCGGCCGGCGGCGTCCGAAGATCATGACATAAAGGGTGTCGACTCG
GCTCGTTTACGCCGCACTGTTGTGGACAACGCCCGCGCCGCCGCTTCCAAGGAACGTTCCATGACGCTCCTTCAG
GGCCTGAGGCTCTACCCCAAGGCCGTTGCCTGGAGCCTCCTCATTTCCACCTGCATAGTCATGGAGGGATACGAC
ATCAGTCTCGTCAACAACTTCTACGCCTTTCCCCAATTCAAGCGCAAGTACGGCGAGCCCCTCAAGGACGGCACC
TACGAGATCCCTGCTGCATGGCAGGCGGGCTTGAGCAATGGCGCCCAAGTCGGCGAGATAATAGGCCTCTTCATC
AACGGCTTCGTCTCGGAGCGTTTCGGATACCGCTATACCGTCCTGGCCTGTCTCGCTCTCGTCACTGCCTTCACC
GCCGTCTTCTTCACCGCTCCAAACGTTCAGACCCTCCTTGTCGCCGAAATACTCTGCGGCATCCCTTGGGGAATC
TTTCAGACGCTCACTGTGACATATGCCTCCGAAGTCTGCCCGATTGCTTTGCGGGGCTACCTCACCACGTACGTC
AACTTTTGCTGGGGCCTCGGCCAGGAAATCGGTATTGGCGTCATCCGGTCCATGCTACATCGTAACGACGAGTGG
AGTTACCGCATACCCTATGCTCTTCAGTGGATGTGGCCCGTCCCGCTCTTTGTGGGCGTCTGCTTCGCCCCCGAG
TCCCCTTGGTGGCTGGTCCGGAGGGGCAGGATCGAGGAGGCCAAGAGATCCCTCCTGCGCCTCACGAGTCCAGAC
CGCGAGACGGACTTTGACGCCGACGAGACGGTCGCCATGATGGTTCATACTACGGCGCTTGAGGAGAAGATGACC
AAGGGCGCGACATACTGGGACTGCTTCAAGGGCACCGACCTGCGTCGCACCGAGATCGTCTGCATGACTTGGGCC
ATACAGAACCTCAGCGGAAATTCTTTTTCCAATTACTCGACCTACTTCCTCAAGCAGGCCGGTCTGCCCGAAGAG
ACGTCATACTCTTTCGCCCTGGGCCAGTATGCCATCAACATGGTGGGCGTCTTTGGGGCCTGGGGCCTCATGACG
ATGGGTGCCGGTCGTAGATCACTCTACCTCTACGGACTCTGCGGACTCTGCGCCATGCTCTTTATTTTGGGCTTC
CTCGGCCTCGTGCCCGAGAGGCAACGCCCAATGGCATCAATGGCTACAGGCAGCATCATGATCCTCTGGGCACTG
ATCTATCAGCTCACTGTGGGTACGGTCTGCTATTCGCTCGTCAGCGAGCTGTCTTCGCGCCGGCTGCAGATCAAG
ACGGTCGTTCTGGGCCGAAACCTTTACAATGTCGTGGGCATCATAACTGGCGTCTTGACGCCTTACATGCTGAAT
CCGGGCGCTTGGAACTGGAGAAACTTCACCGGCTTCTTCTGGGCAGGCATATGCTTTCTCTGCATCGTGTACACG
TATTTCCGTCTGCCGGAACCAAAGGGCCGGACATTTGCAGAGCTCGACGTGCTATTCGACCAGCGGGTGAGTGCC
CGCAAGTTTGCCTCGACCGAGGTGGATGTCTTCCACGAGACTTTGGAGGAGACAGTGGTGAGCGAGTACGAGGCC
GTCTTTGACTCACGGCCGGCCGTGGAGAAGACATGA
Transcript >Ophun1|1014
ATGGCTCTCACCACGTTCGAGTTCGTTCCGCGGCCGGCGGCGTCCGAAGATCATGACATAAAGGGTGTCGACTCG
GCTCGTTTACGCCGCACTGTTGTGGACAACGCCCGCGCCGCCGCTTCCAAGGAACGTTCCATGACGCTCCTTCAG
GGCCTGAGGCTCTACCCCAAGGCCGTTGCCTGGAGCCTCCTCATTTCCACCTGCATAGTCATGGAGGGATACGAC
ATCAGTCTCGTCAACAACTTCTACGCCTTTCCCCAATTCAAGCGCAAGTACGGCGAGCCCCTCAAGGACGGCACC
TACGAGATCCCTGCTGCATGGCAGGCGGGCTTGAGCAATGGCGCCCAAGTCGGCGAGATAATAGGCCTCTTCATC
AACGGCTTCGTCTCGGAGCGTTTCGGATACCGCTATACCGTCCTGGCCTGTCTCGCTCTCGTCACTGCCTTCACC
GCCGTCTTCTTCACCGCTCCAAACGTTCAGACCCTCCTTGTCGCCGAAATACTCTGCGGCATCCCTTGGGGAATC
TTTCAGACGCTCACTGTGACATATGCCTCCGAAGTCTGCCCGATTGCTTTGCGGGGCTACCTCACCACGTACGTC
AACTTTTGCTGGGGCCTCGGCCAGGAAATCGGTATTGGCGTCATCCGGTCCATGCTACATCGTAACGACGAGTGG
AGTTACCGCATACCCTATGCTCTTCAGTGGATGTGGCCCGTCCCGCTCTTTGTGGGCGTCTGCTTCGCCCCCGAG
TCCCCTTGGTGGCTGGTCCGGAGGGGCAGGATCGAGGAGGCCAAGAGATCCCTCCTGCGCCTCACGAGTCCAGAC
CGCGAGACGGACTTTGACGCCGACGAGACGGTCGCCATGATGGTTCATACTACGGCGCTTGAGGAGAAGATGACC
AAGGGCGCGACATACTGGGACTGCTTCAAGGGCACCGACCTGCGTCGCACCGAGATCGTCTGCATGACTTGGGCC
ATACAGAACCTCAGCGGAAATTCTTTTTCCAATTACTCGACCTACTTCCTCAAGCAGGCCGGTCTGCCCGAAGAG
ACGTCATACTCTTTCGCCCTGGGCCAGTATGCCATCAACATGGTGGGCGTCTTTGGGGCCTGGGGCCTCATGACG
ATGGGTGCCGGTCGTAGATCACTCTACCTCTACGGACTCTGCGGACTCTGCGCCATGCTCTTTATTTTGGGCTTC
CTCGGCCTCGTGCCCGAGAGGCAACGCCCAATGGCATCAATGGCTACAGGCAGCATCATGATCCTCTGGGCACTG
ATCTATCAGCTCACTGTGGGTACGGTCTGCTATTCGCTCGTCAGCGAGCTGTCTTCGCGCCGGCTGCAGATCAAG
ACGGTCGTTCTGGGCCGAAACCTTTACAATGTCGTGGGCATCATAACTGGCGTCTTGACGCCTTACATGCTGAAT
CCGGGCGCTTGGAACTGGAGAAACTTCACCGGCTTCTTCTGGGCAGGCATATGCTTTCTCTGCATCGTGTACACG
TATTTCCGTCTGCCGGAACCAAAGGGCCGGACATTTGCAGAGCTCGACGTGCTATTCGACCAGCGGGTGAGTGCC
CGCAAGTTTGCCTCGACCGAGGTGGATGTCTTCCACGAGACTTTGGAGGAGACAGTGGTGAGCGAGTACGAGGCC
GTCTTTGACTCACGGCCGGCCGTGGAGAAGACATGA
Gene >Ophun1|1014
ATGGCTCTCACCACGTTCGAGTTCGTTCCGCGGCCGGCGGCGTCCGAAGATCATGACATAAAGGGTGTCGACTCG
GCTCGTTTACGCCGCACTGTTGTGGACAACGCCCGCGCCGCCGCTTCCAAGGAACGTTCCATGACGCTCCTTCAG
GGCCTGAGGCTCTACCCCAAGGCCGTTGCCTGGAGCCTCCTCATTTCCACCTGCATAGTCATGGAGGGATACGAC
ATCAGTCTCGTCAACAACTTCTGTAAGCTCACCTCTCAGGCCAGTGCTTCTCGCATCGACTGACGTCGAAACATC
CAGACGCCTTTCCCCAATTCAAGCGCAAGTACGGCGAGCCCCTCAAGGACGGCACCTACGAGATCCCTGCTGCAT
GGCAGGCGGGCTTGAGCAATGTCGGTGACCCATCGGAGGGCACGCCTACAGGCCCCTCTACGCTGCCTTGAACTC
GCACTGATTCGATCCTCAAACATGCATCGGTTATAGGGCGCCCAAGTCGGCGAGATAATAGGCCTCTTCATCAAC
GGCTTCGTCTCGGAGCGTTTCGGATACCGCTATACCGTCCTGGCCTGTCTCGCTCTCGTCACTGCCTTCACCGCC
GTCTTCTTCACCGCTCCAAACGTTCAGACCCTCCTTGTCGCCGAAATACTCTGCGGCATCCCTTGGGGAATCTTT
CAGACGCTCACTGTGACATATGCCTCCGAAGTCTGCCCGATTGCTTTGCGGGGCTACCTCACCACGTACGTCAAC
TTTTGCTGGGGCCTCGGCCAGGAAATCGGTATTGGCGTCATCCGGTCCATGCTACATCGTAACGACGAGTGGAGT
TACCGCATACCCTATGCTCTTCAGTGGATGTGGCCCGTCCCGCTCTTTGTGGGCGTCTGCTTCGCCCCCGAGTCC
CCTTGGTGGCTGGTCCGGAGGGGCAGGATCGAGGAGGCCAAGAGATCCCTCCTGCGCCTCACGAGTCCAGACCGC
GAGACGGACTTTGACGCCGACGAGACGGTCGCCATGATGGTTCATACTACGGCGCTTGAGGAGAAGATGACCAAG
GGCGCGACATACTGGGACTGCTTCAAGGGCACCGACCTGCGTCGCACCGAGATCGTCTGCATGACTTGGGCCATA
CAGAACCTCAGCGGAAATTCTTTTTCCAATTACTCGACCTACTTCCTCAAGCAGGCCGGTCTGCCCGAAGAGACG
TCATACTCTTTCGCCCTGGGCCAGTATGCCATCAACATGGTGGGCGTCTTTGGGGCCTGGGGCCTCATGACGATG
GGTGCCGGTCGTAGATCACTCTACCTCTACGGACTCTGCGGACTCTGCGCCATGCTCTTTATTTTGGGCTTCCTC
GGCCTCGTGCCCGAGAGGCAACGCCCAATGGCATCAATGGCTACAGGCAGCATCATGATCCTCTGGGCACTGATC
TATCAGCTCACTGTGGGTACGGTCTGCTATTCGCTCGTCAGCGAGCTGTCTTCGCGCCGGCTGCAGATCAAGACG
GTCGTTCTGGGCCGAAACCTTTAGTACGTCGGGACGATGCTGCCGAGGGGTTTATGGGGTTACCACTGACCGAGG
CAGCAGCAATGTCGTGGGCATCATAACTGGCGTCTTGACGCCTTACATGCTGAATCCGGGCGCTTGGAACTGGAG
AAACTTCACCGGCTTCTTCTGGGTAAGGGAGGAGTTCGCCTTTGTCTGGCGACTACAGATCTGGTGCTGACTCCG
ATGCTTTAGGCAGGCATATGCTTTCTCTGCATCGTGTACACGTATTTCCGTCTGCCGGAACCAAAGGGCCGGACA
TTTGCAGAGCTCGACGTGCTATTCGACCAGCGGGTGAGTGCCCGCAAGTTTGCCTCGACCGAGGTGGATGTCTTC
CACGAGACTTTGGAGGAGACAGTGGTGAGCGAGTACGAGGCCGTCTTTGACTCACGGCCGGCCGTGGAGAAGACA
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail