Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1012
Gene name
LocationContig_138:2127..3916
Strand+
Gene length (bp)1789
Transcript length (bp)1620
Coding sequence length (bp)1620
Protein length (aa) 540

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.8E-11 88 382
PF00083 Sugar_tr Sugar (and other) transporter 2.6E-08 87 292
PF00083 Sugar_tr Sugar (and other) transporter 2.1E-05 418 524

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 30 538 2.0E-92
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 65 537 2.0E-28
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 68 536 8.0E-23
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 68 536 1.0E-22
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 68 536 1.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 30 538 2.0E-92
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 65 537 2.0E-28
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 68 536 8.0E-23
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 68 536 1.0E-22
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 68 536 1.0E-22
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 68 536 6.0E-22
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 68 536 8.0E-22
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 68 536 1.0E-20
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 84 503 4.0E-13
sp|Q6PDF3|SVOPL_MOUSE Putative transporter SVOPL OS=Mus musculus GN=Svopl PE=2 SV=1 65 536 2.0E-12
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 123 500 1.0E-09
sp|Q940M4|OCT7_ARATH Organic cation/carnitine transporter 7 OS=Arabidopsis thaliana GN=OCT7 PE=2 SV=1 69 536 5.0E-09
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 59 503 3.0E-08
sp|Q01MW8|PHT14_ORYSI Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. indica GN=PHT1-4 PE=2 SV=2 122 498 3.0E-08
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 120 292 7.0E-08
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 120 292 7.0E-08
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 120 292 7.0E-08
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 120 292 8.0E-08
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 120 292 8.0E-08
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 67 292 8.0E-08
sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 120 292 9.0E-08
sp|Q504N2|S22AF_MOUSE Solute carrier family 22 member 15 OS=Mus musculus GN=Slc22a15 PE=2 SV=3 130 516 9.0E-08
sp|Q8H6H2|PHT14_ORYSJ Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. japonica GN=PHT1-4 PE=2 SV=1 122 498 1.0E-07
sp|Q8IZD6|S22AF_HUMAN Solute carrier family 22 member 15 OS=Homo sapiens GN=SLC22A15 PE=2 SV=1 100 517 2.0E-07
sp|Q7X7V2|PHT15_ORYSJ Probable inorganic phosphate transporter 1-5 OS=Oryza sativa subsp. japonica GN=PHT1-5 PE=2 SV=2 69 199 3.0E-07
sp|Q6NUB3|S22AF_XENLA Solute carrier family 22 member 15 OS=Xenopus laevis GN=slc22a15 PE=2 SV=2 100 530 5.0E-07
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 67 292 9.0E-07
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 67 292 1.0E-06
sp|P38055|YDJE_ECOLI Inner membrane metabolite transport protein YdjE OS=Escherichia coli (strain K12) GN=ydjE PE=1 SV=2 69 532 2.0E-06
sp|Q7ZX53|S22FL_XENLA Solute carrier family 22 member 15-like OS=Xenopus laevis GN=slc22a15b PE=2 SV=1 114 530 3.0E-06
sp|Q9Z2I6|SV2C_RAT Synaptic vesicle glycoprotein 2C OS=Rattus norvegicus GN=Sv2c PE=1 SV=1 73 292 6.0E-06
sp|Q8H074|PT112_ORYSJ Probable inorganic phosphate transporter 1-12 OS=Oryza sativa subsp. japonica GN=PHT1-12 PE=2 SV=1 129 498 6.0E-06
sp|Q8H6G8|PHT18_ORYSJ Probable inorganic phosphate transporter 1-8 OS=Oryza sativa subsp. japonica GN=PHT1-8 PE=2 SV=1 63 292 7.0E-06
sp|Q96303|PHT14_ARATH Inorganic phosphate transporter 1-4 OS=Arabidopsis thaliana GN=PHT1-4 PE=1 SV=1 69 498 8.0E-06
sp|Q70BM6|S22A8_PIG Solute carrier family 22 member 8 OS=Sus scrofa GN=SLC22A8 PE=2 SV=1 130 527 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 85 107 22
2 122 142 20
3 149 168 19
4 178 200 22
5 207 229 22
6 253 275 22
7 355 377 22
8 397 416 19
9 423 442 19
10 447 469 22
11 482 504 22
12 509 531 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1012
MVGITFDEAAIRGPDRDAITTALHRPPTGYPPEKLEAGESIQSISSGSAEDVLALQDVDPVLNMKMHLVNDAIDE
IGWTPYHLKLFFLNGFGYAVDSMILNFQSNITANAYLEIGHGGYRNALTIAVYCGMLSGALFWGFFADIIGRRLA
FNLSLFLSAICCISAGLMPSWSSLGLFIALVGFGSGGNLILDSVVFLEYLPSSKQSILTMLACWWGIGQAASTAI
AWIFLRDSQAQWNCKVNQHCDWDTNAGWRYALFTGGGLVLTLSLLRVTVIRLRETPKYQLSNGKDAELVETFHVL
ATKYGRPCSLTMDKLEACGTIKFTGRRDRFFLTEMLAHVGGLFSTKTLAQSTIMIWLSWSVIGLAYALFYAFLPA
YFDARGQELNRSGNNNKWRNLIFTDLSGVPGPILAGLLCNWRVLGRRYTLLIGAVCTAPFFVAYPSVHTSTQDLI
MTCFIAFFINVYYSTLYAYTPEVLPSPHRATGNGIAVAFNRVMGIVAAVVAATTKTATAAPFYICGGLLMTAAAF
VPLLPLEPCGRRSS*
Coding >Ophun1|1012
ATGGTCGGCATTACATTTGACGAGGCTGCCATCCGGGGCCCAGACCGCGATGCCATCACCACGGCCCTGCACCGT
CCGCCGACGGGTTACCCGCCTGAGAAGCTGGAGGCGGGGGAGTCGATTCAGAGCATCTCTTCTGGGAGCGCCGAG
GATGTCTTGGCTTTGCAGGACGTTGACCCGGTGCTGAACATGAAGATGCATCTCGTCAACGACGCCATCGATGAG
ATTGGATGGACGCCGTACCATCTGAAGCTGTTCTTCCTCAACGGTTTCGGCTACGCGGTCGACTCCATGATCCTC
AACTTCCAGAGCAACATCACAGCAAATGCCTACCTCGAGATAGGCCACGGCGGCTACCGCAACGCACTCACCATA
GCTGTCTACTGCGGCATGCTCTCCGGTGCTCTCTTCTGGGGCTTCTTTGCCGACATCATCGGCCGGAGGCTTGCC
TTTAACCTGTCGCTCTTCCTGAGCGCCATCTGCTGCATTTCCGCCGGCCTCATGCCCAGCTGGTCTTCGCTCGGT
CTTTTCATCGCCCTCGTCGGCTTCGGCAGCGGCGGCAATCTCATCCTCGACTCCGTCGTCTTTCTCGAGTATCTG
CCCAGCTCGAAGCAGAGCATCTTGACGATGCTCGCCTGCTGGTGGGGGATCGGCCAGGCCGCTTCCACTGCCATC
GCCTGGATCTTCCTGAGAGACAGCCAGGCGCAATGGAACTGCAAGGTCAACCAGCATTGCGACTGGGACACCAAC
GCTGGCTGGCGCTATGCCCTCTTCACCGGCGGCGGCCTCGTGCTCACCCTGTCGCTACTTCGCGTCACGGTTATT
CGCCTGCGCGAGACGCCCAAGTACCAACTCAGCAACGGCAAGGACGCCGAGCTCGTCGAGACGTTTCACGTACTC
GCGACCAAGTATGGCCGTCCTTGCTCGCTGACAATGGACAAGCTCGAGGCCTGCGGCACCATCAAGTTCACCGGT
CGAAGGGATCGCTTCTTTCTCACCGAGATGCTGGCTCATGTTGGCGGCCTCTTTTCGACCAAAACCTTGGCGCAG
TCGACGATTATGATCTGGCTCTCGTGGTCAGTCATCGGCCTGGCCTATGCTCTCTTTTACGCTTTCTTGCCGGCG
TACTTCGATGCCCGCGGCCAGGAATTGAATCGCTCAGGGAACAACAATAAGTGGCGCAACTTGATCTTCACTGAT
CTGTCCGGTGTGCCGGGACCGATCCTGGCCGGCTTACTCTGCAACTGGAGGGTGCTGGGCCGCAGATACACCCTG
TTGATTGGAGCCGTCTGCACTGCTCCCTTCTTCGTGGCCTATCCCTCGGTCCACACGTCGACGCAGGACCTGATT
ATGACGTGCTTCATCGCCTTTTTTATAAATGTCTATTACAGTACACTTTACGCCTACACGCCCGAGGTGCTCCCC
AGCCCTCATCGGGCGACGGGCAACGGCATCGCAGTTGCGTTTAATCGGGTCATGGGAATCGTGGCGGCAGTGGTA
GCCGCGACGACTAAAACGGCGACTGCGGCGCCCTTCTACATCTGCGGCGGGCTGCTCATGACGGCGGCCGCGTTT
GTTCCCTTGCTTCCGCTGGAGCCCTGCGGCCGGAGGAGCTCGTGA
Transcript >Ophun1|1012
ATGGTCGGCATTACATTTGACGAGGCTGCCATCCGGGGCCCAGACCGCGATGCCATCACCACGGCCCTGCACCGT
CCGCCGACGGGTTACCCGCCTGAGAAGCTGGAGGCGGGGGAGTCGATTCAGAGCATCTCTTCTGGGAGCGCCGAG
GATGTCTTGGCTTTGCAGGACGTTGACCCGGTGCTGAACATGAAGATGCATCTCGTCAACGACGCCATCGATGAG
ATTGGATGGACGCCGTACCATCTGAAGCTGTTCTTCCTCAACGGTTTCGGCTACGCGGTCGACTCCATGATCCTC
AACTTCCAGAGCAACATCACAGCAAATGCCTACCTCGAGATAGGCCACGGCGGCTACCGCAACGCACTCACCATA
GCTGTCTACTGCGGCATGCTCTCCGGTGCTCTCTTCTGGGGCTTCTTTGCCGACATCATCGGCCGGAGGCTTGCC
TTTAACCTGTCGCTCTTCCTGAGCGCCATCTGCTGCATTTCCGCCGGCCTCATGCCCAGCTGGTCTTCGCTCGGT
CTTTTCATCGCCCTCGTCGGCTTCGGCAGCGGCGGCAATCTCATCCTCGACTCCGTCGTCTTTCTCGAGTATCTG
CCCAGCTCGAAGCAGAGCATCTTGACGATGCTCGCCTGCTGGTGGGGGATCGGCCAGGCCGCTTCCACTGCCATC
GCCTGGATCTTCCTGAGAGACAGCCAGGCGCAATGGAACTGCAAGGTCAACCAGCATTGCGACTGGGACACCAAC
GCTGGCTGGCGCTATGCCCTCTTCACCGGCGGCGGCCTCGTGCTCACCCTGTCGCTACTTCGCGTCACGGTTATT
CGCCTGCGCGAGACGCCCAAGTACCAACTCAGCAACGGCAAGGACGCCGAGCTCGTCGAGACGTTTCACGTACTC
GCGACCAAGTATGGCCGTCCTTGCTCGCTGACAATGGACAAGCTCGAGGCCTGCGGCACCATCAAGTTCACCGGT
CGAAGGGATCGCTTCTTTCTCACCGAGATGCTGGCTCATGTTGGCGGCCTCTTTTCGACCAAAACCTTGGCGCAG
TCGACGATTATGATCTGGCTCTCGTGGTCAGTCATCGGCCTGGCCTATGCTCTCTTTTACGCTTTCTTGCCGGCG
TACTTCGATGCCCGCGGCCAGGAATTGAATCGCTCAGGGAACAACAATAAGTGGCGCAACTTGATCTTCACTGAT
CTGTCCGGTGTGCCGGGACCGATCCTGGCCGGCTTACTCTGCAACTGGAGGGTGCTGGGCCGCAGATACACCCTG
TTGATTGGAGCCGTCTGCACTGCTCCCTTCTTCGTGGCCTATCCCTCGGTCCACACGTCGACGCAGGACCTGATT
ATGACGTGCTTCATCGCCTTTTTTATAAATGTCTATTACAGTACACTTTACGCCTACACGCCCGAGGTGCTCCCC
AGCCCTCATCGGGCGACGGGCAACGGCATCGCAGTTGCGTTTAATCGGGTCATGGGAATCGTGGCGGCAGTGGTA
GCCGCGACGACTAAAACGGCGACTGCGGCGCCCTTCTACATCTGCGGCGGGCTGCTCATGACGGCGGCCGCGTTT
GTTCCCTTGCTTCCGCTGGAGCCCTGCGGCCGGAGGAGCTCGTGA
Gene >Ophun1|1012
ATGGTCGGCATTACATTTGACGAGGCTGCCATCCGGGGCCCAGACCGCGATGCCATCACCACGGCCCTGCACCGT
CCGCCGACGGGTTACCCGCCTGAGAAGCTGGAGGCGGGGGAGTCGATTCAGAGCATCTCTTCTGGGAGCGCCGAG
GATGTCTTGGCTTTGCAGGACGTTGACCCGGTGCTGAACATGAAGATGCATCTCGTCAACGACGTGAGTCTAAGG
GCCATAGGCTTCTTTGGCTTGTTTCTCGCGCTGAGTCTTCGTCTGGCCAGGCCATCGATGAGATTGGATGGACGC
CGTACCATCTGAAGCTGTTCTTCCTCAACGGTTTCGGGTCAGTTACTTACGGATGCCTCGTCGGATCAATGTGCT
CACCAACTCTCGCAGCTACGCGGTCGACTCCATGATCCTCAACTTCCAGAGCAACATCACAGCAAATGCCTACCT
CGAGATAGGCCACGGCGGCTACCGCAACGCACTCACCATAGCTGTCTACTGCGGCATGCTCTCCGGTGCTCTCTT
CTGGGGCTTCTTTGCCGACATCATCGGCCGGAGGCTTGCCTTTAACCTGTCGCTCTTCCTGAGCGCCATCTGCTG
CATTTCCGCCGGCCTCATGCCCAGCTGGTCTTCGCTCGGTCTTTTCATCGCCCTCGTCGGCTTCGGCAGCGGCGG
CAATCTCATCCTCGACTCCGTCGTCTTTCTCGAGTATCTGCCCAGCTCGAAGCAGAGCATCTTGACGATGCTCGC
CTGCTGGTGGGGGATCGGCCAGGCCGCTTCCACTGCCATCGCCTGGATCTTCCTGAGAGACAGCCAGGCGCAATG
GAACTGCAAGGTCAACCAGCATTGCGACTGGGACACCAACGCTGGCTGGCGCTATGCCCTCTTCACCGGCGGCGG
CCTCGTGCTCACCCTGTCGCTACTTCGCGTCACGGTTATTCGCCTGCGCGAGACGCCCAAGTACCAACTCAGCAA
CGGCAAGGACGCCGAGCTCGTCGAGACGTTTCACGTACTCGCGACCAAGTATGGCCGTCCTTGCTCGCTGACAAT
GGACAAGCTCGAGGCCTGCGGCACCATCAAGTTCACCGGTCGAAGGGATCGCTTCTTTCTCACCGAGATGCTGGC
TCATGTTGGCGGCCTCTTTTCGACCAAAACCTTGGCGCAGTCGACGATTATGATCTGGCTCTCGTGGTCAGTCAT
CGGCCTGGCCTATGCTCTCTTTTACGCTTTCTTGCCGTGAGTTCGCCCGTCTTGTCCCCGTCTTGTCGACCGCCT
AACGTGCAGACTTAGGGCGTACTTCGATGCCCGCGGCCAGGAATTGAATCGCTCAGGGAACAACAATAAGTGGCG
CAACTTGATCTTCACTGATCTGTCCGGTGTGCCGGGACCGATCCTGGCCGGCTTACTCTGCAACTGGAGGGTGCT
GGGCCGCAGATACACCCTGTTGATTGGAGCCGTCTGCACTGCTCCCTTCTTCGTGGCCTATCCCTCGGTCCACAC
GTCGACGCAGGACCTGATTATGACGTGCTTCATCGCCTTTTTTATAAATGTCTATTACAGTACACTTTACGCCTA
CACGCCCGAGGTGCTCCCCAGCCCTCATCGGGCGACGGGCAACGGCATCGCAGTTGCGTTTAATCGGGTCATGGG
AATCGTGGCGGCAGTGGTAGCCGCGACGACTAAAACGGCGACTGCGGCGCCCTTCTACATCTGCGGCGGGCTGCT
CATGACGGCGGCCGCGTTTGTTCCCTTGCTTCCGCTGGAGCCCTGCGGCCGGAGGAGCTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail