Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1006
Gene name
LocationContig_137:27115..29817
Strand-
Gene length (bp)2702
Transcript length (bp)2469
Coding sequence length (bp)2469
Protein length (aa) 823

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 1.7E+01 191 227
PF08238 Sel1 Sel1 repeat 2.7E+02 229 252
PF08238 Sel1 Sel1 repeat 5.1E-01 260 286
PF08238 Sel1 Sel1 repeat 2.3E+02 322 342
PF08238 Sel1 Sel1 repeat 3.0E+02 345 379
PF08238 Sel1 Sel1 repeat 1.7E-01 382 414
PF08238 Sel1 Sel1 repeat 9.9E-05 422 454

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94614|CHR4_SCHPO Chitin synthase regulatory factor 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr4 PE=1 SV=4 110 464 4.0E-45
sp|Q09897|CHR3_SCHPO Chitin synthase regulatory factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr3 PE=1 SV=1 191 472 3.0E-29
sp|P34226|SKT5_YEAST Protein SKT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKT5 PE=1 SV=1 151 548 3.0E-28
sp|Q07622|ACK1_YEAST Activator of C kinase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACK1 PE=1 SV=1 136 466 3.0E-21
sp|O94486|CHR2_SCHPO Chitin synthase regulatory factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr2 PE=3 SV=1 190 414 3.0E-18

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5790
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1756
Ophiocordyceps australis map64 (Brazil) OphauB2|4891
Ophiocordyceps camponoti-floridani Ophcf2|01769
Ophiocordyceps camponoti-rufipedis Ophun1|1006 (this protein)
Ophiocordyceps kimflemingae Ophio5|4969
Ophiocordyceps subramaniannii Hirsu2|9772

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1006
MPSQLSATFVPSGQDDYYLPEVVAPSPQRVTPQIPQTMQEDLQRLELGDGQSSEGASRRGPSSTRTDSRPGRAPE
TPSVDSSYASSPRLDSMDADAPSFSPFPKVSGDNIPPPDDAKEGILWNARKHVLHSQNVSMQMSWARDALVWVDI
AADAAARESADKPRPATPRIEHELREDALNIVNYLARQEYPEALYVRSKWLEFGKFGNRVDKREAYNGYKRAADL
GHARSEYRLGMLFEQSNDMSKAKEHYYKGMGLKDSASLYRMGMMSLLGQHGETKDYPRGLERIQAAADNSDEDAP
QGSYVYGMLVGRDLPDITIPDGLLPYNLETAKMYVEKAAYLGFAKAQLKMGQAYELCQLACEFHPSYSLHYYGLA
ARQGLPEAALGVSRWFLFGYEGVFKKNEELAFKYAQEAALAKLPTGEFAMGYYYEIGIHVNKSIEDARKWYQLAA
EHGNKDAQNRLDSLSQDKSLSKKDHETTTLTRIKSQHGSQRGKRPERFKQPPQMPTLNESGVSPTLDNEARKAAL
AASSATNSPRMSPQPSLGVRPTIVSESASFPDPSRASVVSADRQSAFGIRPDLARPHSAAPYPADERPMANRSRS
TAPYPEDDVAAGPNMYPNMASHSPYADRPISAFAGKAPATGPRPMPMSHSVGSLQPQPAPSSQGSRIASAGYMRT
GPGGNRHASPSPGQAGGRPYDNPQQGRSPSTQPYPSGNRLQKQADMRVSGQGQERLSRVPGATGRPERLGSAPPQ
DPQRPARMSPSPAQMSSRPGMGRIGSAPSTAVLSASSSHSSAGSSAKPKQGPATFEDMGIPQGKQEGDCVVM*
Coding >Ophun1|1006
ATGCCTTCTCAACTCAGTGCCACGTTCGTCCCCAGCGGTCAGGACGATTACTATTTGCCAGAGGTGGTCGCGCCG
TCGCCCCAGAGGGTGACTCCTCAAATACCCCAGACCATGCAAGAGGATCTCCAGCGCCTCGAGCTCGGTGACGGA
CAATCTTCCGAGGGCGCGTCTCGTCGCGGCCCATCGTCAACAAGGACCGACTCGAGGCCTGGACGAGCCCCTGAG
ACGCCATCTGTCGACTCCTCCTACGCCAGCAGCCCCCGGCTCGACAGCATGGATGCAGACGCTCCCTCCTTTTCT
CCTTTTCCCAAGGTCTCGGGCGATAACATCCCCCCGCCCGACGACGCCAAGGAGGGCATCCTGTGGAACGCGCGC
AAGCACGTGCTGCACTCTCAGAATGTCTCGATGCAGATGAGCTGGGCTCGCGATGCCCTCGTCTGGGTCGACATC
GCCGCAGACGCCGCCGCCCGCGAGTCGGCCGACAAGCCCCGTCCCGCCACCCCGCGCATCGAGCACGAGCTGCGC
GAAGACGCCTTGAACATTGTCAACTACCTGGCCCGTCAGGAGTACCCGGAGGCCCTCTATGTTCGCTCCAAATGG
CTCGAATTCGGCAAGTTCGGCAACCGCGTCGACAAGCGCGAGGCCTACAACGGTTACAAACGTGCTGCCGACCTG
GGCCACGCCCGCTCCGAGTACCGCCTCGGCATGCTGTTTGAGCAGTCAAACGACATGTCCAAGGCCAAGGAGCAC
TACTACAAGGGCATGGGCTTGAAGGACTCGGCATCCCTCTACCGCATGGGCATGATGAGCCTGCTCGGTCAGCAC
GGCGAAACCAAGGACTACCCCCGAGGCCTCGAACGTATCCAGGCGGCCGCCGACAACTCCGACGAGGACGCTCCC
CAAGGCTCGTATGTCTACGGCATGCTGGTCGGCAGAGACCTTCCCGACATCACCATCCCCGACGGCCTACTGCCC
TACAACCTGGAGACGGCCAAGATGTACGTCGAAAAGGCCGCCTATCTCGGCTTTGCCAAGGCTCAGCTCAAGATG
GGCCAGGCCTACGAGCTCTGTCAGCTCGCTTGCGAGTTCCATCCGTCCTACTCCCTTCACTACTATGGACTTGCC
GCCCGGCAGGGCCTTCCAGAGGCCGCACTCGGCGTCAGCCGCTGGTTCCTCTTTGGATACGAGGGCGTCTTCAAG
AAGAATGAGGAGCTCGCCTTCAAGTACGCCCAAGAGGCTGCATTGGCCAAGCTGCCGACGGGAGAATTCGCCATG
GGTTACTACTACGAGATTGGCATCCATGTTAATAAGAGTATCGAGGACGCCCGGAAGTGGTATCAGCTTGCGGCC
GAACACGGCAACAAAGACGCGCAGAATCGCCTCGACTCGCTGAGCCAAGACAAGAGCCTGTCGAAGAAGGACCAC
GAGACGACGACATTGACGCGCATCAAGTCTCAGCACGGTTCGCAACGAGGCAAGCGACCTGAGCGGTTCAAGCAG
CCTCCACAAATGCCGACGCTGAACGAGAGCGGCGTGTCACCCACGCTCGACAACGAGGCGCGGAAGGCGGCTTTG
GCGGCATCGTCGGCGACCAACTCCCCACGCATGTCGCCTCAACCGTCTCTGGGCGTCAGACCTACCATTGTATCC
GAGAGCGCATCCTTCCCGGATCCCTCCAGGGCTTCAGTGGTGAGCGCCGACCGACAGTCAGCCTTTGGCATACGG
CCAGACCTTGCGCGTCCGCATTCCGCAGCGCCCTACCCGGCGGACGAACGGCCGATGGCGAACCGGTCGCGATCT
ACGGCGCCGTACCCGGAAGACGACGTGGCCGCAGGGCCCAACATGTATCCCAACATGGCGTCTCACTCGCCTTAC
GCCGATCGTCCCATCAGCGCTTTCGCCGGCAAGGCGCCTGCCACGGGCCCGCGTCCCATGCCCATGTCGCACAGC
GTGGGCAGCCTCCAGCCGCAGCCGGCTCCCTCGTCTCAGGGAAGCAGGATCGCCTCTGCCGGCTACATGCGTACC
GGTCCGGGAGGAAATCGACATGCGAGCCCGAGCCCGGGTCAGGCTGGCGGTCGCCCTTATGATAACCCACAACAG
GGGCGGTCCCCGAGCACGCAGCCGTATCCCAGCGGCAACAGATTGCAGAAGCAAGCCGACATGCGCGTGTCCGGC
CAGGGTCAGGAGCGGCTTTCGAGGGTTCCCGGCGCGACGGGCAGGCCGGAGCGGCTCGGATCGGCGCCTCCGCAG
GATCCACAGAGGCCGGCTCGGATGTCGCCCAGCCCGGCGCAGATGTCTTCGAGGCCGGGAATGGGAAGGATCGGC
AGCGCTCCCTCGACGGCGGTGCTCTCTGCGTCGAGCTCTCACAGCTCGGCAGGCTCGTCGGCCAAACCGAAACAG
GGCCCTGCGACGTTTGAAGATATGGGGATTCCGCAGGGAAAGCAGGAAGGTGATTGTGTTGTCATGTGA
Transcript >Ophun1|1006
ATGCCTTCTCAACTCAGTGCCACGTTCGTCCCCAGCGGTCAGGACGATTACTATTTGCCAGAGGTGGTCGCGCCG
TCGCCCCAGAGGGTGACTCCTCAAATACCCCAGACCATGCAAGAGGATCTCCAGCGCCTCGAGCTCGGTGACGGA
CAATCTTCCGAGGGCGCGTCTCGTCGCGGCCCATCGTCAACAAGGACCGACTCGAGGCCTGGACGAGCCCCTGAG
ACGCCATCTGTCGACTCCTCCTACGCCAGCAGCCCCCGGCTCGACAGCATGGATGCAGACGCTCCCTCCTTTTCT
CCTTTTCCCAAGGTCTCGGGCGATAACATCCCCCCGCCCGACGACGCCAAGGAGGGCATCCTGTGGAACGCGCGC
AAGCACGTGCTGCACTCTCAGAATGTCTCGATGCAGATGAGCTGGGCTCGCGATGCCCTCGTCTGGGTCGACATC
GCCGCAGACGCCGCCGCCCGCGAGTCGGCCGACAAGCCCCGTCCCGCCACCCCGCGCATCGAGCACGAGCTGCGC
GAAGACGCCTTGAACATTGTCAACTACCTGGCCCGTCAGGAGTACCCGGAGGCCCTCTATGTTCGCTCCAAATGG
CTCGAATTCGGCAAGTTCGGCAACCGCGTCGACAAGCGCGAGGCCTACAACGGTTACAAACGTGCTGCCGACCTG
GGCCACGCCCGCTCCGAGTACCGCCTCGGCATGCTGTTTGAGCAGTCAAACGACATGTCCAAGGCCAAGGAGCAC
TACTACAAGGGCATGGGCTTGAAGGACTCGGCATCCCTCTACCGCATGGGCATGATGAGCCTGCTCGGTCAGCAC
GGCGAAACCAAGGACTACCCCCGAGGCCTCGAACGTATCCAGGCGGCCGCCGACAACTCCGACGAGGACGCTCCC
CAAGGCTCGTATGTCTACGGCATGCTGGTCGGCAGAGACCTTCCCGACATCACCATCCCCGACGGCCTACTGCCC
TACAACCTGGAGACGGCCAAGATGTACGTCGAAAAGGCCGCCTATCTCGGCTTTGCCAAGGCTCAGCTCAAGATG
GGCCAGGCCTACGAGCTCTGTCAGCTCGCTTGCGAGTTCCATCCGTCCTACTCCCTTCACTACTATGGACTTGCC
GCCCGGCAGGGCCTTCCAGAGGCCGCACTCGGCGTCAGCCGCTGGTTCCTCTTTGGATACGAGGGCGTCTTCAAG
AAGAATGAGGAGCTCGCCTTCAAGTACGCCCAAGAGGCTGCATTGGCCAAGCTGCCGACGGGAGAATTCGCCATG
GGTTACTACTACGAGATTGGCATCCATGTTAATAAGAGTATCGAGGACGCCCGGAAGTGGTATCAGCTTGCGGCC
GAACACGGCAACAAAGACGCGCAGAATCGCCTCGACTCGCTGAGCCAAGACAAGAGCCTGTCGAAGAAGGACCAC
GAGACGACGACATTGACGCGCATCAAGTCTCAGCACGGTTCGCAACGAGGCAAGCGACCTGAGCGGTTCAAGCAG
CCTCCACAAATGCCGACGCTGAACGAGAGCGGCGTGTCACCCACGCTCGACAACGAGGCGCGGAAGGCGGCTTTG
GCGGCATCGTCGGCGACCAACTCCCCACGCATGTCGCCTCAACCGTCTCTGGGCGTCAGACCTACCATTGTATCC
GAGAGCGCATCCTTCCCGGATCCCTCCAGGGCTTCAGTGGTGAGCGCCGACCGACAGTCAGCCTTTGGCATACGG
CCAGACCTTGCGCGTCCGCATTCCGCAGCGCCCTACCCGGCGGACGAACGGCCGATGGCGAACCGGTCGCGATCT
ACGGCGCCGTACCCGGAAGACGACGTGGCCGCAGGGCCCAACATGTATCCCAACATGGCGTCTCACTCGCCTTAC
GCCGATCGTCCCATCAGCGCTTTCGCCGGCAAGGCGCCTGCCACGGGCCCGCGTCCCATGCCCATGTCGCACAGC
GTGGGCAGCCTCCAGCCGCAGCCGGCTCCCTCGTCTCAGGGAAGCAGGATCGCCTCTGCCGGCTACATGCGTACC
GGTCCGGGAGGAAATCGACATGCGAGCCCGAGCCCGGGTCAGGCTGGCGGTCGCCCTTATGATAACCCACAACAG
GGGCGGTCCCCGAGCACGCAGCCGTATCCCAGCGGCAACAGATTGCAGAAGCAAGCCGACATGCGCGTGTCCGGC
CAGGGTCAGGAGCGGCTTTCGAGGGTTCCCGGCGCGACGGGCAGGCCGGAGCGGCTCGGATCGGCGCCTCCGCAG
GATCCACAGAGGCCGGCTCGGATGTCGCCCAGCCCGGCGCAGATGTCTTCGAGGCCGGGAATGGGAAGGATCGGC
AGCGCTCCCTCGACGGCGGTGCTCTCTGCGTCGAGCTCTCACAGCTCGGCAGGCTCGTCGGCCAAACCGAAACAG
GGCCCTGCGACGTTTGAAGATATGGGGATTCCGCAGGGAAAGCAGGAAGGTGATTGTGTTGTCATGTGA
Gene >Ophun1|1006
ATGCCTTCTCAACTCAGTGCCACGTTCGTCCCCAGCGGTCAGGACGATTACTATTTGCCAGAGGTGGTCGCGCCG
TCGCCCCAGAGGTAGGTTAGACGGGCAACTTTTTTGTCCCAACTACCACCAACTACCTACACCTACACCCACCTA
CCATCAAAGACTCCCGTTTCTTTTTCCACGTGCAACATTCCGATGCGCGCGTTGGCTCTGGCCGCCGGTACCTAC
GGCTCCCTCGGGTGGGGTCCGCGCTGATGACCTTTCAATTTCCAGGGTGACTCCTCAAATACCCCAGACCATGCA
AGAGGATCTCCAGCGCCTCGAGCTCGGTGACGGACAATCTTCCGAGGGCGCGTCTCGTCGCGGCCCATCGTCAAC
AAGGACCGACTCGAGGCCTGGACGAGCCCCTGAGACGCCATCTGTCGACTCCTCCTACGCCAGCAGCCCCCGGCT
CGACAGCATGGATGCAGACGCTCCCTCCTTTTCTCCTTTTCCCAAGGTCTCGGGCGATAACATCCCCCCGCCCGA
CGACGCCAAGGAGGGCATCCTGTGGAACGCGCGCAAGCACGTGCTGCACTCTCAGAATGTCTCGATGCAGATGAG
CTGGGCTCGCGATGCCCTCGTCTGGGTCGACATCGCCGCAGACGCCGCCGCCCGCGAGTCGGCCGACAAGCCCCG
TCCCGCCACCCCGCGCATCGAGCACGAGCTGCGCGAAGACGCCTTGAACATTGTCAACTACCTGGCCCGTCAGGA
GTACCCGGAGGCCCTCTATGTTCGCTCCAAATGGCTCGAATTCGGCAAGTTCGGCAACCGCGTCGACAAGCGCGA
GGCCTACAACGGTTACAAACGTGCTGCCGACCTGGGCCACGCCCGCTCCGAGTACCGCCTCGGCATGCTGTTTGA
GCAGTCAAACGACATGTCCAAGGCCAAGGAGCACTACTACAAGGGCATGGGCTTGAAGGACTCGGCATCCCTCTA
CCGCATGGGCATGATGAGCCTGCTCGGTCAGCACGGCGAAACCAAGGACTACCCCCGAGGCCTCGAACGTATCCA
GGCGGCCGCCGACAACTCCGACGAGGACGCTCCCCAAGGCTCGTATGTCTACGGCATGCTGGTCGGCAGAGACCT
TCCCGACATCACCATCCCCGACGGCCTACTGCCCTACAACCTGGAGACGGCCAAGATGTACGTCGAAAAGGCCGC
CTATCTCGGCTTTGCCAAGGCTCAGCTCAAGATGGGCCAGGCCTACGAGCTCTGTCAGCTCGCTTGCGAGTTCCA
TCCGTCCTACTCCCTTCACTACTATGGACTTGCCGCCCGGCAGGGCCTTCCAGAGGCCGCACTCGGCGTCAGCCG
CTGGTTCCTCTTTGGATACGAGGGCGTCTTCAAGAAGAATGAGGAGCTCGCCTTCAAGTACGCCCAAGAGGCTGC
ATTGGCCAAGCTGCCGACGGGAGAATTCGCCATGGGTTACTACTACGAGATTGGCATCCATGTTAATAAGAGTAT
CGAGGACGCCCGGAAGTGGTATCAGCTTGCGGCCGAACACGGCAACAAAGACGCGCAGAATCGCCTCGACTCGCT
GAGCCAAGACAAGAGCCTGTCGAAGAAGGACCACGAGACGACGACATTGACGCGCATCAAGTCTCAGCACGGTTC
GCAACGAGGCAAGCGACCTGAGCGGTTCAAGCAGCCTCCACAAATGCCGACGCTGAACGAGAGCGGCGTGTCACC
CACGCTCGACAACGAGGCGCGGAAGGCGGCTTTGGCGGCATCGTCGGCGACCAACTCCCCACGCATGTCGCCTCA
ACCGTCTCTGGGCGTCAGACCTACCATTGTATCCGAGAGCGCATCCTTCCCGGATCCCTCCAGGGCTTCAGTGGT
GAGCGCCGACCGACAGTCAGCCTTTGGCATACGGCCAGACCTTGCGCGTCCGCATTCCGCAGCGCCCTACCCGGC
GGACGAACGGCCGATGGCGAACCGGTCGCGATCTACGGCGCCGTACCCGGAAGACGACGTGGCCGCAGGGCCCAA
CATGTATCCCAACATGGCGTCTCACTCGCCTTACGCCGATCGTCCCATCAGCGCTTTCGCCGGCAAGGCGCCTGC
CACGGGCCCGCGTCCCATGCCCATGTCGCACAGCGTGGGCAGCCTCCAGCCGCAGCCGGCTCCCTCGTCTCAGGG
AAGCAGGATCGCCTCTGCCGGCTACATGCGTACCGGTCCGGGAGGAAATCGACATGCGAGCCCGAGCCCGGGTCA
GGCTGGCGGTCGCCCTTATGATAACCCACAACAGGGGCGGTCCCCGAGCACGCAGCCGTATCCCAGCGGCAACAG
ATTGCAGAAGCAAGCCGACATGCGCGTGTCCGGCCAGGGTCAGGAGCGGCTTTCGAGGGTTCCCGGCGCGACGGG
CAGGCCGGAGCGGCTCGGATCGGCGCCTCCGCAGGATCCACAGAGGCCGGCTCGGATGTCGCCCAGCCCGGCGCA
GATGTCTTCGAGGCCGGGAATGGGAAGGATCGGCAGCGCTCCCTCGACGGCGGTGCTCTCTGCGTCGAGCTCTCA
CAGCTCGGCAGGCTCGTCGGCCAAACCGAAACAGGGCCCTGCGACGTTTGAAGATATGGGGATTCCGCAGGGAAA
GCAGGAAGGTGATTGTGTAAGTGTGATTTGCGTGATGCTTGAGGCGAAATCTAACGTCGACGCAGGTTGTCATGT
GA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail