Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1
Gene name
LocationContig_1:2404..4715
Strand+
Gene length (bp)2311
Transcript length (bp)1653
Coding sequence length (bp)1653
Protein length (aa) 551

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04182 B-block_TFIIIC B-block binding subunit of TFIIIC 6.5E-13 18 84

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup378
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7576
Ophiocordyceps australis map64 (Brazil) OphauB2|3739
Ophiocordyceps camponoti-floridani Ophcf2|04740
Ophiocordyceps camponoti-floridani Ophcf2|04741
Ophiocordyceps camponoti-rufipedis Ophun1|1 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2
Ophiocordyceps kimflemingae Ophio5|4150
Ophiocordyceps kimflemingae Ophio5|4151
Ophiocordyceps subramaniannii Hirsu2|1081

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1
MWEVVTGHSVDPKRIPRSEWLLLLGIAKSKSHGILQGDLGRLVDQDKRSVPKRTDSLAKKGYICKRTTLVRGTKT
SKMWLRAFAPPLPKEYDDVQVPKADLNLPLHLLAENLDPVPWRIRWTGQDIDYTALATTILAIIKEWEVIRVRDL
KAKLGVLGMRWQMKTVAKTCRYLNARGVIQFVAANPRQGRKCFCPRNFQHWTARIGERFLRFAGGIFAGSDDLNS
YCFMRSAELVREAQNLLKVQEQPEARPEPSRPPVASRLKPGVTLDLTIEDSPDAVVPPAQDSTQGLKIGPIRKSV
DPFPSSSNGTQPDSEAHEVSLLAASSSKGRGSAGRGRGRGRGRGRGRGWSRGKARQPSAISAGQRPWKCENCGGS
WKNEVGLKYHLQRSKTTCNPFYDPSAPRTSWAARQASHPNTQESPASDDDASLKLFEGPTTLCTETPQVGGLHSR
YRQRLAKISKSGDTTQAELRRILVSASPLVPELWHKSALPFTGIDRTKNSTSRVWNNRRDQQQARLLQNLLPPML
INKAMRILNISGDIKQAPIFRNSHM*
Coding >Ophun1|1
ATGTGGGAGGTCGTGACCGGTCATTCCGTGGATCCCAAACGAATCCCTCGATCCGAATGGCTCCTGCTCCTGGGC
ATAGCCAAAAGCAAATCGCATGGCATCTTGCAGGGCGACCTGGGCCGCCTTGTAGATCAGGACAAGCGCTCTGTC
CCCAAGCGGACAGATTCTTTGGCAAAGAAAGGCTACATCTGCAAGAGGACGACTCTGGTCAGAGGGACCAAGACA
AGCAAGATGTGGCTAAGGGCTTTTGCGCCGCCATTACCCAAAGAATACGACGATGTCCAAGTTCCGAAAGCAGAT
CTTAATTTGCCACTGCACCTGCTCGCTGAGAACTTGGATCCAGTTCCGTGGCGCATTCGTTGGACGGGCCAGGAC
ATCGACTATACGGCACTTGCCACTACTATACTGGCCATCATTAAAGAATGGGAAGTTATTCGCGTCAGAGACTTG
AAGGCCAAGTTGGGAGTCCTTGGCATGCGATGGCAGATGAAGACTGTGGCTAAGACTTGCCGATATCTCAATGCG
CGCGGCGTGATTCAATTTGTCGCTGCAAACCCCCGTCAGGGTCGCAAATGTTTCTGCCCTCGCAACTTCCAGCAT
TGGACAGCCCGCATCGGCGAGCGATTTCTACGGTTCGCTGGCGGCATCTTTGCCGGATCGGACGACCTCAACTCT
TACTGCTTTATGCGGTCCGCAGAGCTTGTCAGAGAAGCTCAGAACCTGCTCAAGGTACAGGAACAGCCCGAGGCC
AGGCCTGAGCCGAGCAGACCCCCAGTCGCATCGAGGCTCAAACCGGGCGTAACACTTGATCTTACCATTGAAGAC
AGCCCCGATGCAGTAGTGCCACCAGCACAAGACAGCACTCAAGGGCTGAAGATTGGGCCCATCCGCAAGTCTGTG
GACCCGTTTCCGAGCAGCAGCAACGGGACACAACCAGACTCTGAGGCGCATGAAGTGTCCTTGTTGGCCGCCTCC
AGCAGCAAAGGTCGCGGCTCGGCTGGCCGGGGCCGGGGCCGGGGCCGGGGCCGGGGCCGGGGCCGGGGCTGGAGC
AGAGGCAAGGCACGGCAGCCTTCTGCCATTTCGGCAGGTCAGCGACCTTGGAAGTGTGAAAACTGCGGTGGCAGC
TGGAAGAACGAGGTTGGCCTGAAATATCACCTACAAAGGTCGAAGACCACCTGCAATCCATTCTACGATCCTTCT
GCCCCCCGTACGAGTTGGGCCGCCCGGCAAGCGAGCCATCCGAATACCCAGGAATCACCTGCTTCGGACGATGAT
GCGTCGCTGAAGCTGTTCGAAGGGCCGACAACTCTTTGCACCGAAACTCCCCAGGTCGGTGGTCTTCATAGCCGT
TATAGACAGCGGCTCGCCAAGATCAGCAAGTCAGGAGACACAACGCAGGCGGAGCTACGGCGGATTCTGGTTTCG
GCCTCACCACTTGTCCCGGAACTTTGGCACAAAAGCGCCCTGCCATTTACGGGAATAGACCGCACGAAAAACTCA
ACGTCCCGCGTGTGGAACAATCGACGCGATCAGCAGCAAGCACGGCTGCTTCAGAACTTGCTGCCTCCGATGTTG
ATAAACAAGGCCATGAGGATCCTCAACATCTCCGGCGACATCAAACAAGCACCGATATTCAGAAACAGTCACATG
TGA
Transcript >Ophun1|1
ATGTGGGAGGTCGTGACCGGTCATTCCGTGGATCCCAAACGAATCCCTCGATCCGAATGGCTCCTGCTCCTGGGC
ATAGCCAAAAGCAAATCGCATGGCATCTTGCAGGGCGACCTGGGCCGCCTTGTAGATCAGGACAAGCGCTCTGTC
CCCAAGCGGACAGATTCTTTGGCAAAGAAAGGCTACATCTGCAAGAGGACGACTCTGGTCAGAGGGACCAAGACA
AGCAAGATGTGGCTAAGGGCTTTTGCGCCGCCATTACCCAAAGAATACGACGATGTCCAAGTTCCGAAAGCAGAT
CTTAATTTGCCACTGCACCTGCTCGCTGAGAACTTGGATCCAGTTCCGTGGCGCATTCGTTGGACGGGCCAGGAC
ATCGACTATACGGCACTTGCCACTACTATACTGGCCATCATTAAAGAATGGGAAGTTATTCGCGTCAGAGACTTG
AAGGCCAAGTTGGGAGTCCTTGGCATGCGATGGCAGATGAAGACTGTGGCTAAGACTTGCCGATATCTCAATGCG
CGCGGCGTGATTCAATTTGTCGCTGCAAACCCCCGTCAGGGTCGCAAATGTTTCTGCCCTCGCAACTTCCAGCAT
TGGACAGCCCGCATCGGCGAGCGATTTCTACGGTTCGCTGGCGGCATCTTTGCCGGATCGGACGACCTCAACTCT
TACTGCTTTATGCGGTCCGCAGAGCTTGTCAGAGAAGCTCAGAACCTGCTCAAGGTACAGGAACAGCCCGAGGCC
AGGCCTGAGCCGAGCAGACCCCCAGTCGCATCGAGGCTCAAACCGGGCGTAACACTTGATCTTACCATTGAAGAC
AGCCCCGATGCAGTAGTGCCACCAGCACAAGACAGCACTCAAGGGCTGAAGATTGGGCCCATCCGCAAGTCTGTG
GACCCGTTTCCGAGCAGCAGCAACGGGACACAACCAGACTCTGAGGCGCATGAAGTGTCCTTGTTGGCCGCCTCC
AGCAGCAAAGGTCGCGGCTCGGCTGGCCGGGGCCGGGGCCGGGGCCGGGGCCGGGGCCGGGGCCGGGGCTGGAGC
AGAGGCAAGGCACGGCAGCCTTCTGCCATTTCGGCAGGTCAGCGACCTTGGAAGTGTGAAAACTGCGGTGGCAGC
TGGAAGAACGAGGTTGGCCTGAAATATCACCTACAAAGGTCGAAGACCACCTGCAATCCATTCTACGATCCTTCT
GCCCCCCGTACGAGTTGGGCCGCCCGGCAAGCGAGCCATCCGAATACCCAGGAATCACCTGCTTCGGACGATGAT
GCGTCGCTGAAGCTGTTCGAAGGGCCGACAACTCTTTGCACCGAAACTCCCCAGGTCGGTGGTCTTCATAGCCGT
TATAGACAGCGGCTCGCCAAGATCAGCAAGTCAGGAGACACAACGCAGGCGGAGCTACGGCGGATTCTGGTTTCG
GCCTCACCACTTGTCCCGGAACTTTGGCACAAAAGCGCCCTGCCATTTACGGGAATAGACCGCACGAAAAACTCA
ACGTCCCGCGTGTGGAACAATCGACGCGATCAGCAGCAAGCACGGCTGCTTCAGAACTTGCTGCCTCCGATGTTG
ATAAACAAGGCCATGAGGATCCTCAACATCTCCGGCGACATCAAACAAGCACCGATATTCAGAAACAGTCACATG
TGA
Gene >Ophun1|1
ATGTGGGAGGTCGTGACCGGTCATTCCGTGGATCCCAAACGAATCCCTCGATCCGAATGGCTCCTGCTCCTGGGC
ATAGCCAAAAGCAAATCGCATGGCATCTTGCAGGGCGACCTGGGCCGCCTTGTAGATCAGGACAAGCGCTCTGTC
CCCAAGCGGACAGATTCTTTGGCAAAGAAAGGCTACATCTGCAAGAGGACGACTCTGGTCAGAGGGACCAAGACA
AGCAAGATGTGGCTAAGGGCTTTTGCGCCGCCATTACCCAAAGAATACGACGATGTCCAAGTTCCGAAAGCAGAT
CTTAATTTGCCACTGCACCTGCTCGCTGAGAACTTGGATCCAGTTCCGTGGCGCATTCGTTGGACGGGCCAGGAC
ATCGACTATACGGCACTTGCCACTACTATACTGGCCATCATTAAAGAATGGGAAGTTATTCGCGTCAGAGACTTG
AAGGCCAAGTTGGGAGTCCTTGGCATGCGATGGCAGATGAAGACTGTGGCTAAGACTTGCCGATATCTCAATGCG
CGCGGCGTGATTCAATTTGTCGCTGCAAAGTTAGACAACCGAGTTTTCAAGGACTGTGTGAAGTTTCGTCGAGAG
ATGGAGGCGCAAGACTGGGCCATCTACCTATCCACTGGAAGGCGTGGAGGAAAATTGTACAGGGGTGACCACTCC
TCAGCCGACGGGTTGGACGAGGGAGACCAATACAACATGGAGAGAGCCGATTTGACTCGTCTGAGCTTATGCCCG
CCTTGGTCTCTGGACAAGCCCCTGCCGCAAACGATCGCTAGACTGGTTCAGTCTCTCGGAGAAAATGGGCTATCG
AACCCTGACATTTATGCGTTGACGCTCGGCGCTACCTTCAATCGCTTTCTTTCATCTTTGACCGGGTCTTTATCC
ACGTCAGATCTGCAGCCGCAGTATTTGCGGCATTGGCAGATGCGGAGTGAGCATGTTCGAACAGGGAAAATAGCG
TCTTATCTTTTCTTTCTGCCGTCAGCCCCCGTCAGGGTCGCAAATGTTTCTGCCCTCGCAACTTCCAGCATTGGA
CAGCCCGCATCGGCGAGCGATTTCTACGGTTCGCTGGCGGCATCTTTGCCGGATCGGACGACCTCAACTCTTACT
GCTTTATGCGTGGGCGGAATTCGTCGAAAGCGCAAAAGGGGATTTGCACCCCATCAAGCGACATCGAAGATGCGT
GCATCACGGCCGCTGAACGGGTGGTGTTCTTCAGGGTCCGCAGAGCTTGTCAGAGAAGCTCAGAACCTGCTCAAG
GTACAGGAACAGCCCGAGGCCAGGCCTGAGCCGAGCAGACCCCCAGTCGCATCGAGGCTCAAACCGGGCGTAACA
CTTGATCTTACCATTGAAGACAGCCCCGATGCAGTAGTGCCACCAGCACAAGACAGCACTCAAGGGCTGAAGATT
GGGCCCATCCGCAAGTCTGTGGACCCGTTTCCGAGCAGCAGCAACGGGACACAACCAGACTCTGAGGCGCATGAA
GTGTCCTTGTTGGCCGCCTCCAGCAGCAAAGGTCGCGGCTCGGCTGGCCGGGGCCGGGGCCGGGGCCGGGGCCGG
GGCCGGGGCCGGGGCTGGAGCAGAGGCAAGGCACGGCAGCCTTCTGCCATTTCGGCAGGTCAGCGACCTTGGAAG
TGTGAAAACTGCGGTGGCAGCTGGAAGAACGAGGTTGGCCTGAAATATCACCTACAAAGGTCGAAGACCACCTGC
AATCCATTCTACGATCCTTCTGCCCCCCGTACGAGTTGGGCCGCCCGGCAAGCGAGCCATCCGAATACCCAGGAA
TCACCTGCTTCGGACGATGATGCGTCGCTGAAGCTGTTCGAAGGGCCGACAACTCTTTGCACCGAAACTCCCCAG
GTCGGTGGTCTTCATAGCCGTTATAGACAGCGGCTCGCCAAGATCAGCAAGTCAGGAGACACAACGCAGGCGGAG
CTACGGCGGATTCTGGTTTCGGCCTCACCACTTGTCCCGGAACTTTGGGTACGGCCAGCAACATCGCTCAACGAA
GCCGAGCAGCATTCTGCTCCATGTGTTTCTCCCAATGTGATCCTTCTAGATACATCAAGCTTGCCACGCCAGGTT
TTGCCCGCAGCACAAAAGCGCCCTGCCATTTACGGGAATAGACCGCACGAAAAACTCAACGTCCCGCGTGTGGAA
CAATCGACGCGATCAGCAGCAAGCACGGCTGCTTCAGAACTTGCTGCCTCCGATGTTGATAAACAAGGCCATGAG
GATCCTCAACATCTCCGGCGACATCAAACAAGCACCGATATTCAGAAACAGTCACATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail