Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|994
Gene name
Locationscaffold_13:56547..57399
Strand+
Gene length (bp)852
Transcript length (bp)603
Coding sequence length (bp)600
Protein length (aa) 200

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14273 DUF4360 Domain of unknown function (DUF4360) 3.3E-45 24 198

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4ATM6|A7590_ARTBC Uncharacterized secreted protein ARB_07590 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07590 PE=1 SV=1 22 198 1.0E-18
sp|D4AV98|A0107_ARTBC Uncharacterized secreted protein ARB_00107 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00107 PE=1 SV=1 13 198 6.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|994
MHFLAALVPFMGLAFAAPQAAPKNVKIHGVSLLGSGCPPKSADVQIDATGSLFEATFSEYQVQSGPNTRASDWRR
NCKLTINMEYSPGFQFSILKTDMIGFAEIPAGAKGQCINTFSFTNDAEKHVDYVMKLNGHYSGAFDLASQAGVAS
WSPCGGSTAILNMNTACSLSPTHLPALIAVDHISGKLKVKFALQWQSCRK
Coding >Ophio5|994
ATGCACTTCCTCGCCGCCCTCGTTCCCTTCATGGGCCTTGCTTTCGCTGCCCCTCAAGCGGCCCCCAAGAACGTC
AAGATACATGGAGTTAGCCTGTTGGGGAGTGGTTGTCCACCGAAGAGCGCTGATGTGCAAATCGACGCAACCGGA
AGTCTTTTCGAAGCCACCTTTTCCGAGTATCAAGTCCAGTCTGGTCCCAACACGCGCGCTTCGGATTGGCGCCGA
AACTGCAAACTGACCATCAACATGGAGTACTCGCCGGGTTTCCAGTTCTCCATCCTTAAGACTGACATGATCGGT
TTCGCCGAGATCCCTGCCGGCGCAAAGGGCCAGTGCATCAACACCTTCTCTTTTACCAATGACGCGGAAAAGCAC
GTCGACTACGTCATGAAGCTCAATGGGCACTACAGCGGCGCATTTGACTTGGCATCTCAGGCTGGCGTTGCAAGC
TGGTCTCCCTGCGGCGGCAGCACCGCAATCCTCAACATGAACACGGCCTGCAGCCTGTCTCCAACTCATCTTCCC
GCTCTCATTGCCGTCGACCACATCAGCGGCAAGCTCAAGGTTAAGTTTGCTCTCCAGTGGCAGAGCTGCCGCAAG
Transcript >Ophio5|994
ATGCACTTCCTCGCCGCCCTCGTTCCCTTCATGGGCCTTGCTTTCGCTGCCCCTCAAGCGGCCCCCAAGAACGTC
AAGATACATGGAGTTAGCCTGTTGGGGAGTGGTTGTCCACCGAAGAGCGCTGATGTGCAAATCGACGCAACCGGA
AGTCTTTTCGAAGCCACCTTTTCCGAGTATCAAGTCCAGTCTGGTCCCAACACGCGCGCTTCGGATTGGCGCCGA
AACTGCAAACTGACCATCAACATGGAGTACTCGCCGGGTTTCCAGTTCTCCATCCTTAAGACTGACATGATCGGT
TTCGCCGAGATCCCTGCCGGCGCAAAGGGCCAGTGCATCAACACCTTCTCTTTTACCAATGACGCGGAAAAGCAC
GTCGACTACGTCATGAAGCTCAATGGGCACTACAGCGGCGCATTTGACTTGGCATCTCAGGCTGGCGTTGCAAGC
TGGTCTCCCTGCGGCGGCAGCACCGCAATCCTCAACATGAACACGGCCTGCAGCCTGTCTCCAACTCATCTTCCC
GCTCTCATTGCCGTCGACCACATCAGCGGCAAGCTCAAGGTTAAGTTTGCTCTCCAGTGGCAGAGCTGCCGCAAG
TAA
Gene >Ophio5|994
ATGCACTTCCTCGCCGCCCTCGTTCCCTTCATGGGCCTTGCTTTCGCTGCCCCTCAAGCGGCCCCCAAGAACGTC
AAGATACATGGAGTTAGCCTGTTGGGGAGTGGTTGTCCACCGAAGAGCGCTGATGTGCAAATCGACGCAACCGGA
AGTCTTTTCGAAGCCACCTTTTCCGAGTATCAAGTCCAGTCTGGTCCCAACACGCGCGCTTCGGATTGGCGCCGA
AACTGCAAACTGACCAGTAAGTATTCTTATTTCCTACTTCAAGACATTATCGCGGAAGCTTTGGCTAACATATCT
TACCAACTAGTCAACATGGAGTACTCGCCGGGTTTCCAGTTAGTTTTCTTCTCATTTCGCCGTGGCTCGTGGTTC
GCGCCTTCATGGAAATCAATACTGACTCTGTTGTCTAGGTTCTCCATCCTTAAGACTGACATGATCGGTTTCGCC
GAGATCCCTGCCGGCGCAAAGGGCCAGGTTAGTACACTTCGCGACTTCTTCAGCAACCTCTCCACTAACAATATC
TACAGTGCATCAACACCTTCTCTTTTACCAATGACGCGGAAAAGCACGTCGACTACGTCATGAAGCTCAATGGGC
ACTACAGCGGCGCATTTGACTTGGCATCTCAGGCTGGCGTTGCAAGCTGGTCTCCCTGCGGCGGCAGCACCGCAA
TCCTCAACATGAACACGGCCTGCAGCCTGTCTCCAACTCATCTTCCCGCTCTCATTGCCGTAAGTCTGGATGCCT
CCTCATCACTTCAGCAGGGGAACTGAACCATTGCAGGTCGACCACATCAGCGGCAAGCTCAAGGTTAAGTTTGCT
CTCCAGTGGCAGAGCTGCCGCAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail