Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|983
Gene name
Locationscaffold_13:26008..27899
Strand+
Gene length (bp)1891
Transcript length (bp)1722
Coding sequence length (bp)1719
Protein length (aa) 573

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06687 SUR7 SUR7/PalI family 7.3E-15 62 516

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0016020 membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 59 81 22
2 425 447 22
3 459 481 22
4 501 523 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|983
MSESILSEERTTQARFKSLTKKAAAWLPSKLTGRQKSTTNVYPESLLGKVANVLQSRVVVGLNLIFTFIGFILVI
LALFAGHKRGFMEQHSIIRLDTSTLGSNLISTAVDAVDLNTTVLGQEVIGALAGMGGNNTGFNKGGSAVGIAPGN
TSGNTPGIAPGNTPGNAPGNTPANTPXXXXXXXXXXXXXXXXXXXXXXXXXLPTLLPTLSAMLSATLSTDQKDEA
SAADEGNQVRRDRQDGQRGGGTNNFLGDRARQPGNGRSRGPRNANDQQLPQVGGAIGGVIGGAINGIANGGVGDV
LEGLATPIVSKAFDAMQSAFDNFKASFKSSPASSNIAKQVTSRLGIADWYSLHVNSICQGNFDAGGKPVATRCTS
SPAQRLDAAKGLAQPLGIGPVTLNLANTGLPDTLDQFIGYGNAFLLVIFLFYVFGMIFSTLSLASTIGSLFLRNT
FPVLLTNAVLANSASMVVFLGTVVVTAAASFFSNSLKNLGPTIGLKIELGYQFQVLTWFAAVLLMLPAAYRLLQL
IVDIVERRQDKKSQEAANIVAEKHAEAEEEDFDPTGETHIGVAKSADY
Coding >Ophio5|983
ATGTCGGAATCGATACTCTCCGAGGAGCGCACCACACAAGCGCGATTCAAGTCCTTGACGAAGAAAGCTGCAGCA
TGGCTTCCTTCCAAATTGACAGGCAGGCAAAAGTCGACGACGAATGTCTACCCAGAGAGCCTTCTCGGCAAAGTT
GCAAATGTTCTGCAAAGTCGTGTTGTGGTAGGACTTAATCTGATATTCACATTCATTGGATTCATCCTTGTGATA
CTGGCTCTTTTTGCCGGCCACAAAAGGGGGTTCATGGAGCAACATAGTATAATCAGGCTGGACACTTCGACTTTG
GGTAGTAACCTCATCAGTACTGCCGTTGATGCTGTTGATCTGAACACGACGGTGCTCGGCCAAGAAGTGATTGGG
GCGTTGGCGGGAATGGGGGGGAACAACACCGGTTTCAACAAGGGTGGCAGCGCTGTTGGCATCGCTCCTGGGAAC
ACTTCTGGCAACACTCCTGGCATCGCTCCTGGGAACACTCCGGGCAACGCTCCTGGCAACACTCCTGCCAACACT
CCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NTCCTGCCAACACTCCTGCCAACGCTGTCGGCAATGCTGTCGGCAACGCTATCGACCGACCAGAAAGATGAAGCC
AGCGCAGCCGACGAGGGCAACCAAGTCCGTCGAGACCGGCAGGATGGACAGCGCGGTGGCGGAACGAACAACTTT
CTGGGTGACCGGGCAAGGCAACCCGGCAACGGCAGATCTAGAGGTCCGAGGAACGCAAACGATCAACAGTTGCCA
CAAGTCGGCGGAGCCATTGGGGGCGTCATCGGTGGCGCGATAAATGGGATCGCCAATGGTGGCGTGGGAGACGTG
TTGGAGGGCCTGGCCACCCCAATTGTGAGCAAAGCCTTCGATGCTATGCAGTCCGCATTCGACAACTTCAAGGCA
TCATTCAAGAGCAGTCCCGCCAGCTCCAATATAGCCAAACAAGTCACCTCAAGGCTGGGTATTGCGGATTGGTAT
TCACTGCATGTCAACAGCATATGCCAGGGCAACTTCGATGCTGGGGGAAAGCCGGTTGCCACGCGCTGCACCTCC
TCCCCGGCCCAGCGACTGGATGCCGCTAAAGGTCTAGCACAGCCACTCGGCATTGGCCCGGTTACTTTGAACCTC
GCCAATACTGGGCTGCCTGACACTCTTGATCAGTTTATCGGCTATGGCAACGCATTCTTGCTAGTGATATTTCTC
TTTTACGTCTTCGGCATGATATTCAGCACCCTCTCTTTGGCTTCCACAATAGGGAGTCTTTTTCTGCGGAACACA
TTTCCGGTGCTTTTGACTAACGCGGTTCTCGCGAACAGCGCTTCAATGGTGGTTTTCCTTGGTACCGTTGTGGTT
ACCGCAGCTGCCTCCTTCTTTTCAAATTCACTGAAGAATCTTGGTCCGACCATCGGTCTCAAGATCGAATTAGGC
TATCAGTTCCAGGTTCTCACCTGGTTCGCGGCAGTTTTGTTGATGTTGCCCGCTGCGTACCGGTTGCTGCAGCTT
ATTGTCGATATAGTGGAGAGGAGGCAAGACAAGAAATCGCAAGAGGCGGCAAACATCGTGGCAGAGAAACACGCG
GAGGCAGAGGAAGAAGATTTCGACCCAACCGGAGAGACCCATATCGGAGTCGCCAAGTCAGCAGACTAC
Transcript >Ophio5|983
ATGTCGGAATCGATACTCTCCGAGGAGCGCACCACACAAGCGCGATTCAAGTCCTTGACGAAGAAAGCTGCAGCA
TGGCTTCCTTCCAAATTGACAGGCAGGCAAAAGTCGACGACGAATGTCTACCCAGAGAGCCTTCTCGGCAAAGTT
GCAAATGTTCTGCAAAGTCGTGTTGTGGTAGGACTTAATCTGATATTCACATTCATTGGATTCATCCTTGTGATA
CTGGCTCTTTTTGCCGGCCACAAAAGGGGGTTCATGGAGCAACATAGTATAATCAGGCTGGACACTTCGACTTTG
GGTAGTAACCTCATCAGTACTGCCGTTGATGCTGTTGATCTGAACACGACGGTGCTCGGCCAAGAAGTGATTGGG
GCGTTGGCGGGAATGGGGGGGAACAACACCGGTTTCAACAAGGGTGGCAGCGCTGTTGGCATCGCTCCTGGGAAC
ACTTCTGGCAACACTCCTGGCATCGCTCCTGGGAACACTCCGGGCAACGCTCCTGGCAACACTCCTGCCAACACT
CCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NTCCTGCCAACACTCCTGCCAACGCTGTCGGCAATGCTGTCGGCAACGCTATCGACCGACCAGAAAGATGAAGCC
AGCGCAGCCGACGAGGGCAACCAAGTCCGTCGAGACCGGCAGGATGGACAGCGCGGTGGCGGAACGAACAACTTT
CTGGGTGACCGGGCAAGGCAACCCGGCAACGGCAGATCTAGAGGTCCGAGGAACGCAAACGATCAACAGTTGCCA
CAAGTCGGCGGAGCCATTGGGGGCGTCATCGGTGGCGCGATAAATGGGATCGCCAATGGTGGCGTGGGAGACGTG
TTGGAGGGCCTGGCCACCCCAATTGTGAGCAAAGCCTTCGATGCTATGCAGTCCGCATTCGACAACTTCAAGGCA
TCATTCAAGAGCAGTCCCGCCAGCTCCAATATAGCCAAACAAGTCACCTCAAGGCTGGGTATTGCGGATTGGTAT
TCACTGCATGTCAACAGCATATGCCAGGGCAACTTCGATGCTGGGGGAAAGCCGGTTGCCACGCGCTGCACCTCC
TCCCCGGCCCAGCGACTGGATGCCGCTAAAGGTCTAGCACAGCCACTCGGCATTGGCCCGGTTACTTTGAACCTC
GCCAATACTGGGCTGCCTGACACTCTTGATCAGTTTATCGGCTATGGCAACGCATTCTTGCTAGTGATATTTCTC
TTTTACGTCTTCGGCATGATATTCAGCACCCTCTCTTTGGCTTCCACAATAGGGAGTCTTTTTCTGCGGAACACA
TTTCCGGTGCTTTTGACTAACGCGGTTCTCGCGAACAGCGCTTCAATGGTGGTTTTCCTTGGTACCGTTGTGGTT
ACCGCAGCTGCCTCCTTCTTTTCAAATTCACTGAAGAATCTTGGTCCGACCATCGGTCTCAAGATCGAATTAGGC
TATCAGTTCCAGGTTCTCACCTGGTTCGCGGCAGTTTTGTTGATGTTGCCCGCTGCGTACCGGTTGCTGCAGCTT
ATTGTCGATATAGTGGAGAGGAGGCAAGACAAGAAATCGCAAGAGGCGGCAAACATCGTGGCAGAGAAACACGCG
GAGGCAGAGGAAGAAGATTTCGACCCAACCGGAGAGACCCATATCGGAGTCGCCAAGTCAGCAGACTACTAA
Gene >Ophio5|983
ATGTCGGAATCGATACTCTCCGAGGAGCGCACCACACAAGCGCGATTCAAGTCCTTGACGAAGAAAGCTGCAGCA
TGGCTTCCTTCCAAATTGACAGGCAGGCAAAAGTCGACGACGAATGTCTACCCAGAGAGCCTTCTCGGCAAAGTT
GCAAATGTTCTGCAAAGTCGTGTTGTGGTAGGACTTAATCTGATATTCACATTCATTGGATTCATCCTTGTGATA
CTGGCTCTTTTTGCCGGCCACAAAAGGGGGTTCATGGAGCAACATAGTATAATCAGGGTAAGAGCATTCATTTAT
CTCGATATCTTTTGTAAATGCTAATTCTTGTTGATCTCAAGCTGGACACTTCGACTTTGGGTAGTAACCTCATCA
GTACTGCCGTTGATGCTGTTGATCTGAACACGACGGTGCTCGGCCAAGAAGTGATTGGGGCGTTGGCGGGAATGG
GGGGGAACAACACCGGTTTCAACAAGGGTGGCAGCGCTGTTGGCATCGCTCCTGGGAACACTTCTGGCAACACTC
CTGGCATCGCTCCTGGGAACACTCCGGGCAACGCTCCTGGCAACACTCCTGCCAACACTCCTNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCCTGCCAACACTCC
TGCCAACGCTGTCGGCAATGCTGTCGGCAACGCTGTCGGCAACACTGCTGGAAATGCCTTGTCTACCATAGGCAA
CCTTTTGACTGGTAGATCGACCGACCAGAAAGATGAAGCCAGCGCAGCCGACGAGGGCAACCAAGTCCGTCGAGA
CCGGCAGGATGGACAGCGCGGTGGCGGAACGAACAACTTTCTGGGTGACCGGGCAAGGCAACCCGGCAACGGCAG
ATCTAGAGGTCCGAGGAACGCAAACGATCAACAGTTGCCACAAGTCGGCGGAGCCATTGGGGGCGTCATCGGTGG
CGCGATAAATGGGATCGCCAATGGTGGCGTGGGAGACGTGTTGGAGGGCCTGGCCACCCCAATTGTGAGCAAAGC
CTTCGATGCTATGCAGTCCGCATTCGACAACTTCAAGGCATCATTCAAGAGCAGTCCCGCCAGCTCCAATATAGC
CAAACAAGTCACCTCAAGGCTGGGTATTGCGGATTGGTATTCACTGCATGTCAACAGCATATGCCAGGGCAACTT
CGATGCTGGGGGAAAGCCGGTTGCCACGCGCTGCACCTCCTCCCCGGCCCGTTAGTTGCTCCCTTTTTGCTCTTG
CACAGAGATCTTACTTACGTATATGCTAGAGCGACTGGATGCCGCTAAAGGTCTAGCACAGCCACTCGGCATTGG
CCCGGTTACTTTGAACCTCGCCAATACTGGGCTGCCTGACACTCTTGATCAGTTTATCGGCTATGGCAACGCATT
CTTGCTAGTGATATTTCTCTTTTACGTCTTCGGCATGATATTCAGCACCCTCTCTTTGGCTTCCACAATAGGGAG
TCTTTTTCTGCGGAACACATTTCCGGTGCTTTTGACTAACGCGGTTCTCGCGAACAGCGCTTCAATGGTGGTTTT
CCTTGGTACCGTTGTGGTTACCGCAGCTGCCTCCTTCTTTTCAAATTCACTGAAGAATCTTGGTCCGACCATCGG
TCTCAAGATCGAATTAGGCTATCAGTTCCAGGTTCTCACCTGGTTCGCGGCAGTTTTGTTGATGTTGCCCGCTGC
GTACCGGTTGCTGCAGCTTATTGTCGATATAGTGGAGAGGAGGCAAGACAAGAAATCGCAAGAGGCGGCAAACAT
CGTGGCAGAGAAACACGCGGAGGCAGAGGAAGAAGATTTCGACCCAACCGGAGAGACCCATATCGGAGTCGCCAA
GTCAGCAGACTACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail