Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|974
Gene name
Locationscaffold_13:11280..12814
Strand+
Gene length (bp)1534
Transcript length (bp)1395
Coding sequence length (bp)1392
Protein length (aa) 464

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 53 401 1.0E-15
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 10 360 5.0E-13
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 8 347 3.0E-12
sp|Q8K1P8|MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus GN=SLC16A2 PE=1 SV=1 83 427 7.0E-10
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 115 427 4.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 53 401 1.0E-15
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 10 360 5.0E-13
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 8 347 3.0E-12
sp|Q8K1P8|MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus GN=SLC16A2 PE=1 SV=1 83 427 7.0E-10
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 115 427 4.0E-08
sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens GN=SLC16A2 PE=1 SV=2 83 464 7.0E-08
sp|O70324|MOT8_MOUSE Monocarboxylate transporter 8 OS=Mus musculus GN=Slc16a2 PE=1 SV=2 83 394 7.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

Domain # Start End Length
1 38 60 22
2 80 102 22
3 115 137 22
4 142 164 22
5 171 193 22
6 197 219 22
7 243 265 22
8 280 302 22
9 311 330 19
10 335 357 22
11 370 392 22
12 412 434 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 3.66 0.81 6.50
CcL In ants, during behavior modification 284.06 107.66 460.47
CcD In ants, recently dead 82.42 40.51 124.33

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|974
MSATMPATDDEPHRPSLRENDEYDDAQLLLPPTDRGRGAYMALACCTISQAPIWGYSVSFGIFQEYYSNYSDISA
APGAFASIGAAQVGVMYLMMPVIFVILHRRPHWRPWCGRLGMIITTASISASAFASTVGSLIVTQGVLYAFGCSL
LFSPISVYMDEWFVKFKGAAYGFMWGGKSAVGVGMPFVFSALLRSFGLRVTLLSWAAASALLTLPALVFMKPRLP
LPITHRVRPLSWDFVRRTIFWMMQLGVVIQSLGYMMPATYLASYAFNIGFPSVTGPLLLALFSLASVPGSIIHGF
LGDKVSASKAILVSSLGSAVPVFLLWGLSLDLANLIAFGLTFGFFAGGFSSTWSGMVNEIQRSDAAADSSIVFGM
LLGGRGIGFVLSGPVSGALLSIRERLTAEPLGYGTIYGPMIIFTGITAILGAWGSYWVIAKAVKPKLLACCSHRG
ASPLEGGLRPERAI
Coding >Ophio5|974
ATGTCGGCCACGATGCCCGCTACCGACGACGAGCCCCATCGCCCGAGCCTACGGGAGAATGACGAATATGATGAT
GCCCAACTGCTGCTACCACCAACGGACCGAGGTCGAGGCGCGTACATGGCTTTGGCCTGCTGCACCATCTCTCAG
GCTCCCATCTGGGGATACTCAGTCTCGTTTGGCATCTTCCAAGAGTACTACAGCAACTACAGCGACATCTCAGCC
GCGCCAGGAGCCTTCGCCTCTATCGGTGCGGCGCAAGTCGGCGTCATGTATCTCATGATGCCCGTCATCTTTGTG
ATTCTTCATCGTCGACCACACTGGCGCCCCTGGTGTGGACGGCTGGGCATGATTATAACGACCGCGAGTATCTCT
GCCTCGGCCTTTGCCTCCACTGTCGGCAGCCTCATCGTCACTCAAGGAGTTCTCTATGCGTTTGGCTGCTCCCTG
CTCTTCAGTCCTATCTCCGTGTACATGGATGAATGGTTCGTCAAGTTCAAGGGCGCGGCGTACGGCTTTATGTGG
GGAGGCAAGTCGGCCGTCGGCGTTGGCATGCCATTCGTTTTCAGCGCTCTGCTTAGGAGCTTCGGCCTTCGGGTT
ACACTCCTCTCGTGGGCCGCTGCGTCTGCTCTACTGACGCTGCCGGCTCTTGTCTTTATGAAGCCGAGGCTGCCT
CTGCCTATTACCCACCGTGTACGGCCCCTCTCCTGGGACTTTGTTCGCCGGACCATCTTCTGGATGATGCAGCTG
GGCGTCGTGATACAGTCGCTGGGGTATATGATGCCTGCCACGTATCTCGCCAGCTACGCGTTCAACATTGGCTTC
CCATCGGTCACCGGGCCACTCCTTCTCGCACTCTTCTCGCTGGCGTCGGTCCCTGGGTCGATAATTCATGGGTTT
CTCGGTGACAAGGTGTCTGCCAGCAAAGCTATCTTGGTATCATCACTCGGCAGTGCTGTTCCCGTCTTCCTGCTC
TGGGGGCTCAGCCTCGACTTGGCAAATCTCATTGCCTTTGGCCTCACCTTTGGCTTCTTTGCTGGTGGTTTCAGT
TCCACCTGGTCAGGTATGGTTAACGAGATCCAACGATCCGACGCCGCCGCCGACTCTTCCATCGTCTTTGGAATG
CTTCTGGGTGGTCGAGGCATAGGCTTCGTTCTGAGCGGCCCTGTCAGCGGAGCCTTGCTCTCAATTCGTGAGAGG
TTGACCGCGGAGCCCTTGGGGTATGGAACGATTTATGGCCCTATGATTATTTTCACTGGCATTACAGCGATACTG
GGTGCCTGGGGTTCCTATTGGGTAATTGCTAAGGCGGTAAAACCGAAACTGCTTGCTTGCTGCTCACATCGTGGT
GCGTCGCCTCTCGAGGGCGGTCTGCGCCCTGAGAGAGCGATT
Transcript >Ophio5|974
ATGTCGGCCACGATGCCCGCTACCGACGACGAGCCCCATCGCCCGAGCCTACGGGAGAATGACGAATATGATGAT
GCCCAACTGCTGCTACCACCAACGGACCGAGGTCGAGGCGCGTACATGGCTTTGGCCTGCTGCACCATCTCTCAG
GCTCCCATCTGGGGATACTCAGTCTCGTTTGGCATCTTCCAAGAGTACTACAGCAACTACAGCGACATCTCAGCC
GCGCCAGGAGCCTTCGCCTCTATCGGTGCGGCGCAAGTCGGCGTCATGTATCTCATGATGCCCGTCATCTTTGTG
ATTCTTCATCGTCGACCACACTGGCGCCCCTGGTGTGGACGGCTGGGCATGATTATAACGACCGCGAGTATCTCT
GCCTCGGCCTTTGCCTCCACTGTCGGCAGCCTCATCGTCACTCAAGGAGTTCTCTATGCGTTTGGCTGCTCCCTG
CTCTTCAGTCCTATCTCCGTGTACATGGATGAATGGTTCGTCAAGTTCAAGGGCGCGGCGTACGGCTTTATGTGG
GGAGGCAAGTCGGCCGTCGGCGTTGGCATGCCATTCGTTTTCAGCGCTCTGCTTAGGAGCTTCGGCCTTCGGGTT
ACACTCCTCTCGTGGGCCGCTGCGTCTGCTCTACTGACGCTGCCGGCTCTTGTCTTTATGAAGCCGAGGCTGCCT
CTGCCTATTACCCACCGTGTACGGCCCCTCTCCTGGGACTTTGTTCGCCGGACCATCTTCTGGATGATGCAGCTG
GGCGTCGTGATACAGTCGCTGGGGTATATGATGCCTGCCACGTATCTCGCCAGCTACGCGTTCAACATTGGCTTC
CCATCGGTCACCGGGCCACTCCTTCTCGCACTCTTCTCGCTGGCGTCGGTCCCTGGGTCGATAATTCATGGGTTT
CTCGGTGACAAGGTGTCTGCCAGCAAAGCTATCTTGGTATCATCACTCGGCAGTGCTGTTCCCGTCTTCCTGCTC
TGGGGGCTCAGCCTCGACTTGGCAAATCTCATTGCCTTTGGCCTCACCTTTGGCTTCTTTGCTGGTGGTTTCAGT
TCCACCTGGTCAGGTATGGTTAACGAGATCCAACGATCCGACGCCGCCGCCGACTCTTCCATCGTCTTTGGAATG
CTTCTGGGTGGTCGAGGCATAGGCTTCGTTCTGAGCGGCCCTGTCAGCGGAGCCTTGCTCTCAATTCGTGAGAGG
TTGACCGCGGAGCCCTTGGGGTATGGAACGATTTATGGCCCTATGATTATTTTCACTGGCATTACAGCGATACTG
GGTGCCTGGGGTTCCTATTGGGTAATTGCTAAGGCGGTAAAACCGAAACTGCTTGCTTGCTGCTCACATCGTGGT
GCGTCGCCTCTCGAGGGCGGTCTGCGCCCTGAGAGAGCGATTTGA
Gene >Ophio5|974
ATGTCGGCCACGATGCCCGCTACCGACGACGAGCCCCATCGCCCGAGCCTACGGGAGAATGACGAATATGATGAT
GCCCAACTGCTGCTACCACCAACGGACCGAGGTCGAGGCGCGTACATGGCTTTGGCCTGCTGCACCATCTCTCAG
GCTCCCATCTGGGGTGAGCCCATGGCCATGCACCCCTCCCTAGCTGCGACGATGGAGGCTTGCTAAAATGGGAAC
CTAAACCTTTCCAGGATACTCAGTCTCGTTTGGCATCTTCCAAGAGTACTACAGCAACTACAGCGACATCTCAGC
CGCGCCAGGAGCCTTCGCCTCTATCGGTGCGGCGCAAGTCGGCGTCATGTATCTCATGATGCCCGTCATCTTTGT
GATTCTTCATCGTCGACCACACTGGCGCCCCTGGTGTGGACGGCTGGGCATGATTATAACGACCGCGAGTATCTC
TGCCTCGGCCTTTGCCTCCACTGTCGGCAGCCTCATCGTCACTCAAGGAGTTCTCTATGCGTTTGGCTGCTCCCT
GCTCTTCAGTCCTATCTCCGTGTACATGGATGAATGGTTCGTCAAGTTCAAGGGCGCGGCGTACGGCTTTATGTG
GGGAGGCAAGTCGGCCGTCGGCGTTGGCATGCCATTCGTTTTCAGCGCTCTGCTTAGGAGCTTCGGCCTTCGGGT
TACACTCCTCTCGTGGGCCGCTGCGTCTGCTCTACTGACGCTGCCGGCTCTTGTCTTTATGAAGCCGAGGCTGCC
TCTGCCTATTACCCACCGTGTACGGCCCCTCTCCTGGGACTTTGTTCGCCGGACCATCTTCTGGATGATGCAGCT
GGGCGTCGTGATACAGTCGCTGGGGTATATGATGCCTGCCACGTATCTCGCCAGCTACGCGTTCAACATTGGCTT
CCCATCGGTCACCGGGCCACTCCTTCTCGCACTCTTCTCGCTGGCGTCGGTCCCTGGGTCGATAATTCATGGGTT
TCTCGGTGACAAGGTGTCTGCCAGCAAAGCTATCTTGGTATCATCACTCGGCAGTGCTGTTCCCGTCTTCCTGCT
CTGGGGGCTCAGCCTCGACTTGGCAAATCTCATTGCCTTTGGCCTCACCTTTGGCTTCTTTGCTGGTATAGCCCC
CTCATTCAAAAGACGTGCGGCCCCGATTGCAGCTGAGCTGATCTTCTGAAAAGGTGGTTTCAGTTCCACCTGGTC
AGGTATGGTTAACGAGATCCAACGATCCGACGCCGCCGCCGACTCTTCCATCGTCTTTGGAATGCTTCTGGGTGG
TCGAGGCATAGGCTTCGTTCTGAGCGGCCCTGTCAGCGGAGCCTTGCTCTCAATTCGTGAGAGGTTGACCGCGGA
GCCCTTGGGGTATGGAACGATTTATGGCCCTATGATTATTTTCACTGGCATTACAGCGATACTGGGTGCCTGGGG
TTCCTATTGGGTAATTGCTAAGGCGGTAAAACCGAAACTGCTTGCTTGCTGCTCACATCGTGGTGCGTCGCCTCT
CGAGGGCGGTCTGCGCCCTGAGAGAGCGATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail