Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|973
Gene name
Locationscaffold_13:8684..10893
Strand+
Gene length (bp)2209
Transcript length (bp)2007
Coding sequence length (bp)2004
Protein length (aa) 668

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain 2.3E-09 173 211
PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain 1.6E-05 220 287

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49008|HEXA_PORGI Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=nahA PE=3 SV=2 121 247 3.0E-12
sp|P96155|HEX1_VIBFU Beta-hexosaminidase OS=Vibrio furnissii GN=exo I PE=1 SV=1 122 286 2.0E-09
sp|P43077|HEX1_CANAX Beta-hexosaminidase OS=Candida albicans GN=HEX1 PE=1 SV=1 121 454 2.0E-09
sp|P13723|HEXA1_DICDI Beta-hexosaminidase subunit A1 OS=Dictyostelium discoideum GN=hexa1 PE=1 SV=1 121 286 7.0E-09
sp|P07686|HEXB_HUMAN Beta-hexosaminidase subunit beta OS=Homo sapiens GN=HEXB PE=1 SV=3 121 307 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49008|HEXA_PORGI Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=nahA PE=3 SV=2 121 247 3.0E-12
sp|P96155|HEX1_VIBFU Beta-hexosaminidase OS=Vibrio furnissii GN=exo I PE=1 SV=1 122 286 2.0E-09
sp|P43077|HEX1_CANAX Beta-hexosaminidase OS=Candida albicans GN=HEX1 PE=1 SV=1 121 454 2.0E-09
sp|P13723|HEXA1_DICDI Beta-hexosaminidase subunit A1 OS=Dictyostelium discoideum GN=hexa1 PE=1 SV=1 121 286 7.0E-09
sp|P07686|HEXB_HUMAN Beta-hexosaminidase subunit beta OS=Homo sapiens GN=HEXB PE=1 SV=3 121 307 1.0E-06
sp|P49614|HEXB_FELCA Beta-hexosaminidase subunit beta OS=Felis catus GN=HEXB PE=2 SV=2 121 237 2.0E-06
sp|Q6AXR4|HEXB_RAT Beta-hexosaminidase subunit beta OS=Rattus norvegicus GN=Hexb PE=2 SV=1 121 237 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|973
MKVEAALLWAGFAVGVALANLPGIPSAPYTPLGSGIFPISRIEIIGVDARHASVRNQHGATLIPPTLRDFAITFG
RDLEAVYGVQAEVIEHRGAVSRRKGVFLTLDDGPGYTDAAGRHTFEGYSLVTNRSGIFIAGASPLGVWWGTRTVL
QQAALYGRIPHGEGQDSPAWGERGMMLDAGRHYYPKSFLIEMCSYMSFFKQNVFHLHLSDNLHNSTAMSHRGVTV
VPEIEAPGHALSIVQWRPQLGLEDLSLLDISHPQTMPTMKLIWREFLPWFHSKVVSIGADEYGGPVSDYNWFVNS
MNTFIRQSSNKSIRIWGTFPPKPSYHINIDQDVSIQHWSYHEDNPYHDYIRKDYSVVNSMGDFYVVNKWGRYPNT
IDISKTFHGDPSIRGKGPWHPHIFNMKNASDNPRRNEPLVLGAIAPLWNDYGPNASVYSEAYYAWRLGLPALADK
QWGGKLTKQQFDFYFRKLHSRIPAQNLDRNIPSKGVVIFEYDLSRGNNVSHGLVKDLTTNGYDASTKCAFRDSSL
LITPRCALVTPWRSKGRDYTLSLKLKISQLADPTNTTLVVGADSVLMLTPNVTLFASGNYYRLNMTVPVGELVEL
TLWGCKKQTFASVKRPGDLGSPKEEEFLVKMGIDGQRFHWDVMAIEAPIEEVTGWNGELFWMRLTRLA
Coding >Ophio5|973
ATGAAGGTGGAAGCCGCGCTACTCTGGGCGGGATTCGCTGTGGGCGTTGCCCTCGCGAACCTTCCGGGAATCCCT
TCAGCGCCCTACACCCCGTTGGGGTCGGGCATCTTCCCCATTTCCAGGATAGAGATTATTGGCGTCGACGCTCGA
CATGCCTCTGTTCGAAATCAGCATGGAGCGACCCTGATTCCTCCCACGCTTCGAGACTTCGCCATTACCTTCGGT
CGCGACCTCGAAGCTGTCTATGGCGTCCAAGCCGAAGTGATTGAGCATCGTGGCGCCGTCAGCCGCCGGAAGGGC
GTCTTTTTGACTCTGGATGACGGTCCGGGCTACACTGACGCCGCAGGACGACACACGTTCGAGGGCTACTCCCTG
GTTACCAACCGCTCGGGCATCTTCATTGCCGGCGCCAGCCCGCTCGGTGTCTGGTGGGGGACTCGGACGGTTCTG
CAGCAGGCTGCCTTGTACGGGCGCATACCCCATGGCGAAGGCCAAGATTCGCCGGCCTGGGGAGAGCGCGGCATG
ATGCTTGACGCAGGCCGGCATTACTATCCCAAGAGCTTCCTCATCGAAATGTGTTCTTACATGTCCTTCTTCAAG
CAAAATGTCTTTCATCTGCATTTGAGCGACAACTTACACAATAGCACCGCAATGAGTCATCGTGGCGTCACCGTC
GTGCCGGAGATTGAGGCGCCCGGTCATGCACTATCTATTGTCCAGTGGCGCCCACAGCTGGGACTCGAGGACCTG
AGCCTCCTCGACATATCCCATCCGCAGACGATGCCGACTATGAAGCTGATCTGGCGCGAGTTCTTGCCGTGGTTT
CATTCCAAGGTTGTCTCCATCGGGGCTGACGAGTACGGAGGACCGGTAAGCGATTATAACTGGTTCGTCAACTCG
ATGAACACCTTCATCCGTCAGTCATCCAACAAATCTATCCGTATTTGGGGCACCTTCCCACCAAAACCGAGCTAC
CACATCAACATTGATCAAGACGTTTCCATTCAGCATTGGAGTTACCACGAGGACAACCCATACCACGACTATATT
CGCAAAGACTACTCCGTTGTCAACTCCATGGGCGATTTCTACGTTGTCAACAAATGGGGCCGCTACCCAAACACC
ATCGACATCTCCAAGACCTTTCACGGCGACCCCTCCATCCGGGGCAAGGGACCCTGGCATCCTCACATCTTCAAC
ATGAAGAATGCATCGGACAACCCCAGACGTAACGAGCCCCTGGTGCTCGGGGCCATCGCGCCGCTATGGAACGAC
TACGGGCCCAACGCGAGTGTCTACTCCGAAGCGTACTACGCATGGCGTCTGGGCTTGCCGGCGTTGGCGGATAAG
CAATGGGGTGGTAAGCTGACCAAACAGCAGTTCGATTTCTATTTCCGTAAACTCCATTCACGCATCCCGGCACAA
AACCTCGACAGAAACATTCCATCTAAGGGGGTCGTCATCTTTGAGTACGACTTAAGCCGTGGCAACAACGTCTCT
CACGGGCTCGTAAAGGATCTGACGACAAACGGTTATGACGCCAGCACGAAGTGCGCATTCCGAGACTCGTCTCTT
CTCATCACGCCAAGATGCGCCTTGGTGACACCATGGCGATCCAAGGGCAGAGACTACACCCTGTCCCTGAAGCTC
AAAATTAGCCAGCTAGCCGATCCGACCAACACTACCCTTGTCGTCGGAGCCGATTCAGTCTTGATGCTCACACCC
AACGTCACCCTCTTCGCGTCGGGAAACTATTACCGGCTCAACATGACTGTGCCCGTCGGCGAACTGGTCGAGCTA
ACCTTATGGGGCTGCAAAAAACAGACCTTTGCTTCGGTTAAGCGCCCAGGGGACTTGGGCTCCCCTAAGGAGGAG
GAGTTCCTCGTGAAGATGGGCATCGATGGCCAGCGGTTCCATTGGGACGTCATGGCCATCGAAGCACCCATAGAG
GAGGTGACGGGATGGAACGGCGAGCTATTCTGGATGCGCTTGACACGCCTGGCA
Transcript >Ophio5|973
ATGAAGGTGGAAGCCGCGCTACTCTGGGCGGGATTCGCTGTGGGCGTTGCCCTCGCGAACCTTCCGGGAATCCCT
TCAGCGCCCTACACCCCGTTGGGGTCGGGCATCTTCCCCATTTCCAGGATAGAGATTATTGGCGTCGACGCTCGA
CATGCCTCTGTTCGAAATCAGCATGGAGCGACCCTGATTCCTCCCACGCTTCGAGACTTCGCCATTACCTTCGGT
CGCGACCTCGAAGCTGTCTATGGCGTCCAAGCCGAAGTGATTGAGCATCGTGGCGCCGTCAGCCGCCGGAAGGGC
GTCTTTTTGACTCTGGATGACGGTCCGGGCTACACTGACGCCGCAGGACGACACACGTTCGAGGGCTACTCCCTG
GTTACCAACCGCTCGGGCATCTTCATTGCCGGCGCCAGCCCGCTCGGTGTCTGGTGGGGGACTCGGACGGTTCTG
CAGCAGGCTGCCTTGTACGGGCGCATACCCCATGGCGAAGGCCAAGATTCGCCGGCCTGGGGAGAGCGCGGCATG
ATGCTTGACGCAGGCCGGCATTACTATCCCAAGAGCTTCCTCATCGAAATGTGTTCTTACATGTCCTTCTTCAAG
CAAAATGTCTTTCATCTGCATTTGAGCGACAACTTACACAATAGCACCGCAATGAGTCATCGTGGCGTCACCGTC
GTGCCGGAGATTGAGGCGCCCGGTCATGCACTATCTATTGTCCAGTGGCGCCCACAGCTGGGACTCGAGGACCTG
AGCCTCCTCGACATATCCCATCCGCAGACGATGCCGACTATGAAGCTGATCTGGCGCGAGTTCTTGCCGTGGTTT
CATTCCAAGGTTGTCTCCATCGGGGCTGACGAGTACGGAGGACCGGTAAGCGATTATAACTGGTTCGTCAACTCG
ATGAACACCTTCATCCGTCAGTCATCCAACAAATCTATCCGTATTTGGGGCACCTTCCCACCAAAACCGAGCTAC
CACATCAACATTGATCAAGACGTTTCCATTCAGCATTGGAGTTACCACGAGGACAACCCATACCACGACTATATT
CGCAAAGACTACTCCGTTGTCAACTCCATGGGCGATTTCTACGTTGTCAACAAATGGGGCCGCTACCCAAACACC
ATCGACATCTCCAAGACCTTTCACGGCGACCCCTCCATCCGGGGCAAGGGACCCTGGCATCCTCACATCTTCAAC
ATGAAGAATGCATCGGACAACCCCAGACGTAACGAGCCCCTGGTGCTCGGGGCCATCGCGCCGCTATGGAACGAC
TACGGGCCCAACGCGAGTGTCTACTCCGAAGCGTACTACGCATGGCGTCTGGGCTTGCCGGCGTTGGCGGATAAG
CAATGGGGTGGTAAGCTGACCAAACAGCAGTTCGATTTCTATTTCCGTAAACTCCATTCACGCATCCCGGCACAA
AACCTCGACAGAAACATTCCATCTAAGGGGGTCGTCATCTTTGAGTACGACTTAAGCCGTGGCAACAACGTCTCT
CACGGGCTCGTAAAGGATCTGACGACAAACGGTTATGACGCCAGCACGAAGTGCGCATTCCGAGACTCGTCTCTT
CTCATCACGCCAAGATGCGCCTTGGTGACACCATGGCGATCCAAGGGCAGAGACTACACCCTGTCCCTGAAGCTC
AAAATTAGCCAGCTAGCCGATCCGACCAACACTACCCTTGTCGTCGGAGCCGATTCAGTCTTGATGCTCACACCC
AACGTCACCCTCTTCGCGTCGGGAAACTATTACCGGCTCAACATGACTGTGCCCGTCGGCGAACTGGTCGAGCTA
ACCTTATGGGGCTGCAAAAAACAGACCTTTGCTTCGGTTAAGCGCCCAGGGGACTTGGGCTCCCCTAAGGAGGAG
GAGTTCCTCGTGAAGATGGGCATCGATGGCCAGCGGTTCCATTGGGACGTCATGGCCATCGAAGCACCCATAGAG
GAGGTGACGGGATGGAACGGCGAGCTATTCTGGATGCGCTTGACACGCCTGGCATGA
Gene >Ophio5|973
ATGAAGGTGGAAGCCGCGCTACTCTGGGCGGGATTCGGTAAGAGTCAGCCCAATACCGCTTTCTAGGCCGCCTAC
AACGGCAGCGTAGCCCGCTCAACGGTCTCCAGCTGTGGGCGTTGCCCTCGCGAACCTTCCGGGAATCCCTTCAGC
GCCCTACACCCCGTTGGGGTCGGGCATCTTCCCCATTTCCAGGATAGAGATTATTGGCGTCGACGCTCGACATGC
CTCTGTTCGAAATCAGCATGGAGCGACCCTGATTCCTCCCACGCTTCGAGACTTCGCCATTACCTTCGGTCGCGA
CCTCGAAGCTGTCTATGGCGTCCAAGCCGAAGTGATTGAGCATCGTGGCGCCGTCAGCCGCCGGAAGGGCGTCTT
TTTGACTCTGGATGACGGTCCGGGCTACACTGACGCCGCAGGACGACACACGTTCGAGGGCTACTCCCTGGTTAC
CAACCGCTCGGGCATCTTCATTGCCGGCGCCAGCCCGCTCGGTGTCTGGTGGGGGACTCGGACGGTTCTGCAGCA
GGCTGCCTTGTACGGGCGCATACCCCATGGCGAAGGCCAAGATTCGCCGGCCTGGGGAGAGCGCGGCATGATGCT
TGACGCAGGCCGGCATTACTATCCCAAGAGCTTCCTCATCGAAATGTGTTCTTACATGTCCTTCTTCAAGCAAAA
TGTCTTTCATCTGCATTTGAGCGACAACTTACACAATAGTAAGGCTTACTCTGCGGAGCAGTCGCTCCGCCTCGG
CGCCTGGTTCCGTCTCTGGTCCGACAACAAGGAGCTGAGCGGGCTTAGCAGGCACCGCAATGAGTCGTACACAAG
GGCCGACTTTGACGAAATTCAGAAGGCTTGCGCAGATCGTGGCGTCACCGTCGTGCCGGAGATTGAGGCGCCCGG
TCATGCACTATCTATTGTCCAGTGGCGCCCACAGCTGGGACTCGAGGACCTGAGCCTCCTCGACATATCCCATCC
GCAGACGATGCCGACTATGAAGCTGATCTGGCGCGAGTTCTTGCCGTGGTTTCATTCCAAGGTTGTCTCCATCGG
GGCTGACGAGTACGGAGGACCGGTAAGCGATTATAACTGGTTCGTCAACTCGATGAACACCTTCATCCGTCAGTC
ATCCAACAAATCTATCCGTATTTGGGGCACCTTCCCACCAAAACCGAGCTACCACATCAACATTGATCAAGACGT
TTCCATTCAGCATTGGAGTTACCACGAGGACAACCCATACCACGACTATATTCGCAAAGACTACTCCGTTGTCAA
CTCCATGGGCGATTTCTACGTTGTCAACAAATGGGGCCGCTACCCAAACACCATCGACATCTCCAAGACCTTTCA
CGGCGACCCCTCCATCCGGGGCAAGGGACCCTGGCATCCTCACATCTTCAACATGAAGAATGCATCGGACAACCC
CAGACGTAACGAGCCCCTGGTGCTCGGGGCCATCGCGCCGCTATGGAACGACTACGGGCCCAACGCGAGTGTCTA
CTCCGAAGCGTACTACGCATGGCGTCTGGGCTTGCCGGCGTTGGCGGATAAGCAATGGGGTGGTAAGCTGACCAA
ACAGCAGTTCGATTTCTATTTCCGTAAACTCCATTCACGCATCCCGGCACAAAACCTCGACAGAAACATTCCATC
TAAGGGGGTCGTCATCTTTGAGTACGACTTAAGCCGTGGCAACAACGTCTCTCACGGGCTCGTAAAGGATCTGAC
GACAAACGGTTATGACGCCAGCACGAAGTGCGCATTCCGAGACTCGTCTCTTCTCATCACGCCAAGATGCGCCTT
GGTGACACCATGGCGATCCAAGGGCAGAGACTACACCCTGTCCCTGAAGCTCAAAATTAGCCAGCTAGCCGATCC
GACCAACACTACCCTTGTCGTCGGAGCCGATTCAGTCTTGATGCTCACACCCAACGTCACCCTCTTCGCGTCGGG
AAACTATTACCGGCTCAACATGACTGTGCCCGTCGGCGAACTGGTCGAGCTAACCTTATGGGGCTGCAAAAAACA
GACCTTTGCTTCGGTTAAGCGCCCAGGGGACTTGGGCTCCCCTAAGGAGGAGGAGTTCCTCGTGAAGATGGGCAT
CGATGGCCAGCGGTTCCATTGGGACGTCATGGCCATCGAAGCACCCATAGAGGAGGTGACGGGATGGAACGGCGA
GCTATTCTGGATGCGCTTGACACGCCTGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail