Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|973
Gene name
Locationscaffold_13:8684..10893
Strand+
Gene length (bp)2209
Transcript length (bp)2007
Coding sequence length (bp)2004
Protein length (aa) 668

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain 2.3E-09 173 211
PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain 1.6E-05 220 287

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49008|HEXA_PORGI Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=nahA PE=3 SV=2 121 247 3.0E-12
sp|P96155|HEX1_VIBFU Beta-hexosaminidase OS=Vibrio furnissii GN=exo I PE=1 SV=1 122 286 2.0E-09
sp|P43077|HEX1_CANAX Beta-hexosaminidase OS=Candida albicans GN=HEX1 PE=1 SV=1 121 454 2.0E-09
sp|P13723|HEXA1_DICDI Beta-hexosaminidase subunit A1 OS=Dictyostelium discoideum GN=hexa1 PE=1 SV=1 121 286 7.0E-09
sp|P07686|HEXB_HUMAN Beta-hexosaminidase subunit beta OS=Homo sapiens GN=HEXB PE=1 SV=3 121 307 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49008|HEXA_PORGI Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=nahA PE=3 SV=2 121 247 3.0E-12
sp|P96155|HEX1_VIBFU Beta-hexosaminidase OS=Vibrio furnissii GN=exo I PE=1 SV=1 122 286 2.0E-09
sp|P43077|HEX1_CANAX Beta-hexosaminidase OS=Candida albicans GN=HEX1 PE=1 SV=1 121 454 2.0E-09
sp|P13723|HEXA1_DICDI Beta-hexosaminidase subunit A1 OS=Dictyostelium discoideum GN=hexa1 PE=1 SV=1 121 286 7.0E-09
sp|P07686|HEXB_HUMAN Beta-hexosaminidase subunit beta OS=Homo sapiens GN=HEXB PE=1 SV=3 121 307 1.0E-06
sp|P49614|HEXB_FELCA Beta-hexosaminidase subunit beta OS=Felis catus GN=HEXB PE=2 SV=2 121 237 2.0E-06
sp|Q6AXR4|HEXB_RAT Beta-hexosaminidase subunit beta OS=Rattus norvegicus GN=Hexb PE=2 SV=1 121 237 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.161 0.104 0.949 0.0797 0.0787 0.0493 0.3927 0.3829 0.1874 0.0171

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999721

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH20 3.8E-31 220 453

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2173
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5053
Ophiocordyceps australis map64 (Brazil) OphauB2|7451
Ophiocordyceps camponoti-floridani Ophcf2|02545
Ophiocordyceps camponoti-rufipedis Ophun1|3599
Ophiocordyceps kimflemingae Ophio5|973 (this protein)
Ophiocordyceps subramaniannii Hirsu2|269

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|973
MKVEAALLWAGFAVGVALANLPGIPSAPYTPLGSGIFPISRIEIIGVDARHASVRNQHGATLIPPTLRDFAITFG
RDLEAVYGVQAEVIEHRGAVSRRKGVFLTLDDGPGYTDAAGRHTFEGYSLVTNRSGIFIAGASPLGVWWGTRTVL
QQAALYGRIPHGEGQDSPAWGERGMMLDAGRHYYPKSFLIEMCSYMSFFKQNVFHLHLSDNLHNSTAMSHRGVTV
VPEIEAPGHALSIVQWRPQLGLEDLSLLDISHPQTMPTMKLIWREFLPWFHSKVVSIGADEYGGPVSDYNWFVNS
MNTFIRQSSNKSIRIWGTFPPKPSYHINIDQDVSIQHWSYHEDNPYHDYIRKDYSVVNSMGDFYVVNKWGRYPNT
IDISKTFHGDPSIRGKGPWHPHIFNMKNASDNPRRNEPLVLGAIAPLWNDYGPNASVYSEAYYAWRLGLPALADK
QWGGKLTKQQFDFYFRKLHSRIPAQNLDRNIPSKGVVIFEYDLSRGNNVSHGLVKDLTTNGYDASTKCAFRDSSL
LITPRCALVTPWRSKGRDYTLSLKLKISQLADPTNTTLVVGADSVLMLTPNVTLFASGNYYRLNMTVPVGELVEL
TLWGCKKQTFASVKRPGDLGSPKEEEFLVKMGIDGQRFHWDVMAIEAPIEEVTGWNGELFWMRLTRLA
Coding >Ophio5|973
ATGAAGGTGGAAGCCGCGCTACTCTGGGCGGGATTCGCTGTGGGCGTTGCCCTCGCGAACCTTCCGGGAATCCCT
TCAGCGCCCTACACCCCGTTGGGGTCGGGCATCTTCCCCATTTCCAGGATAGAGATTATTGGCGTCGACGCTCGA
CATGCCTCTGTTCGAAATCAGCATGGAGCGACCCTGATTCCTCCCACGCTTCGAGACTTCGCCATTACCTTCGGT
CGCGACCTCGAAGCTGTCTATGGCGTCCAAGCCGAAGTGATTGAGCATCGTGGCGCCGTCAGCCGCCGGAAGGGC
GTCTTTTTGACTCTGGATGACGGTCCGGGCTACACTGACGCCGCAGGACGACACACGTTCGAGGGCTACTCCCTG
GTTACCAACCGCTCGGGCATCTTCATTGCCGGCGCCAGCCCGCTCGGTGTCTGGTGGGGGACTCGGACGGTTCTG
CAGCAGGCTGCCTTGTACGGGCGCATACCCCATGGCGAAGGCCAAGATTCGCCGGCCTGGGGAGAGCGCGGCATG
ATGCTTGACGCAGGCCGGCATTACTATCCCAAGAGCTTCCTCATCGAAATGTGTTCTTACATGTCCTTCTTCAAG
CAAAATGTCTTTCATCTGCATTTGAGCGACAACTTACACAATAGCACCGCAATGAGTCATCGTGGCGTCACCGTC
GTGCCGGAGATTGAGGCGCCCGGTCATGCACTATCTATTGTCCAGTGGCGCCCACAGCTGGGACTCGAGGACCTG
AGCCTCCTCGACATATCCCATCCGCAGACGATGCCGACTATGAAGCTGATCTGGCGCGAGTTCTTGCCGTGGTTT
CATTCCAAGGTTGTCTCCATCGGGGCTGACGAGTACGGAGGACCGGTAAGCGATTATAACTGGTTCGTCAACTCG
ATGAACACCTTCATCCGTCAGTCATCCAACAAATCTATCCGTATTTGGGGCACCTTCCCACCAAAACCGAGCTAC
CACATCAACATTGATCAAGACGTTTCCATTCAGCATTGGAGTTACCACGAGGACAACCCATACCACGACTATATT
CGCAAAGACTACTCCGTTGTCAACTCCATGGGCGATTTCTACGTTGTCAACAAATGGGGCCGCTACCCAAACACC
ATCGACATCTCCAAGACCTTTCACGGCGACCCCTCCATCCGGGGCAAGGGACCCTGGCATCCTCACATCTTCAAC
ATGAAGAATGCATCGGACAACCCCAGACGTAACGAGCCCCTGGTGCTCGGGGCCATCGCGCCGCTATGGAACGAC
TACGGGCCCAACGCGAGTGTCTACTCCGAAGCGTACTACGCATGGCGTCTGGGCTTGCCGGCGTTGGCGGATAAG
CAATGGGGTGGTAAGCTGACCAAACAGCAGTTCGATTTCTATTTCCGTAAACTCCATTCACGCATCCCGGCACAA
AACCTCGACAGAAACATTCCATCTAAGGGGGTCGTCATCTTTGAGTACGACTTAAGCCGTGGCAACAACGTCTCT
CACGGGCTCGTAAAGGATCTGACGACAAACGGTTATGACGCCAGCACGAAGTGCGCATTCCGAGACTCGTCTCTT
CTCATCACGCCAAGATGCGCCTTGGTGACACCATGGCGATCCAAGGGCAGAGACTACACCCTGTCCCTGAAGCTC
AAAATTAGCCAGCTAGCCGATCCGACCAACACTACCCTTGTCGTCGGAGCCGATTCAGTCTTGATGCTCACACCC
AACGTCACCCTCTTCGCGTCGGGAAACTATTACCGGCTCAACATGACTGTGCCCGTCGGCGAACTGGTCGAGCTA
ACCTTATGGGGCTGCAAAAAACAGACCTTTGCTTCGGTTAAGCGCCCAGGGGACTTGGGCTCCCCTAAGGAGGAG
GAGTTCCTCGTGAAGATGGGCATCGATGGCCAGCGGTTCCATTGGGACGTCATGGCCATCGAAGCACCCATAGAG
GAGGTGACGGGATGGAACGGCGAGCTATTCTGGATGCGCTTGACACGCCTGGCA
Transcript >Ophio5|973
ATGAAGGTGGAAGCCGCGCTACTCTGGGCGGGATTCGCTGTGGGCGTTGCCCTCGCGAACCTTCCGGGAATCCCT
TCAGCGCCCTACACCCCGTTGGGGTCGGGCATCTTCCCCATTTCCAGGATAGAGATTATTGGCGTCGACGCTCGA
CATGCCTCTGTTCGAAATCAGCATGGAGCGACCCTGATTCCTCCCACGCTTCGAGACTTCGCCATTACCTTCGGT
CGCGACCTCGAAGCTGTCTATGGCGTCCAAGCCGAAGTGATTGAGCATCGTGGCGCCGTCAGCCGCCGGAAGGGC
GTCTTTTTGACTCTGGATGACGGTCCGGGCTACACTGACGCCGCAGGACGACACACGTTCGAGGGCTACTCCCTG
GTTACCAACCGCTCGGGCATCTTCATTGCCGGCGCCAGCCCGCTCGGTGTCTGGTGGGGGACTCGGACGGTTCTG
CAGCAGGCTGCCTTGTACGGGCGCATACCCCATGGCGAAGGCCAAGATTCGCCGGCCTGGGGAGAGCGCGGCATG
ATGCTTGACGCAGGCCGGCATTACTATCCCAAGAGCTTCCTCATCGAAATGTGTTCTTACATGTCCTTCTTCAAG
CAAAATGTCTTTCATCTGCATTTGAGCGACAACTTACACAATAGCACCGCAATGAGTCATCGTGGCGTCACCGTC
GTGCCGGAGATTGAGGCGCCCGGTCATGCACTATCTATTGTCCAGTGGCGCCCACAGCTGGGACTCGAGGACCTG
AGCCTCCTCGACATATCCCATCCGCAGACGATGCCGACTATGAAGCTGATCTGGCGCGAGTTCTTGCCGTGGTTT
CATTCCAAGGTTGTCTCCATCGGGGCTGACGAGTACGGAGGACCGGTAAGCGATTATAACTGGTTCGTCAACTCG
ATGAACACCTTCATCCGTCAGTCATCCAACAAATCTATCCGTATTTGGGGCACCTTCCCACCAAAACCGAGCTAC
CACATCAACATTGATCAAGACGTTTCCATTCAGCATTGGAGTTACCACGAGGACAACCCATACCACGACTATATT
CGCAAAGACTACTCCGTTGTCAACTCCATGGGCGATTTCTACGTTGTCAACAAATGGGGCCGCTACCCAAACACC
ATCGACATCTCCAAGACCTTTCACGGCGACCCCTCCATCCGGGGCAAGGGACCCTGGCATCCTCACATCTTCAAC
ATGAAGAATGCATCGGACAACCCCAGACGTAACGAGCCCCTGGTGCTCGGGGCCATCGCGCCGCTATGGAACGAC
TACGGGCCCAACGCGAGTGTCTACTCCGAAGCGTACTACGCATGGCGTCTGGGCTTGCCGGCGTTGGCGGATAAG
CAATGGGGTGGTAAGCTGACCAAACAGCAGTTCGATTTCTATTTCCGTAAACTCCATTCACGCATCCCGGCACAA
AACCTCGACAGAAACATTCCATCTAAGGGGGTCGTCATCTTTGAGTACGACTTAAGCCGTGGCAACAACGTCTCT
CACGGGCTCGTAAAGGATCTGACGACAAACGGTTATGACGCCAGCACGAAGTGCGCATTCCGAGACTCGTCTCTT
CTCATCACGCCAAGATGCGCCTTGGTGACACCATGGCGATCCAAGGGCAGAGACTACACCCTGTCCCTGAAGCTC
AAAATTAGCCAGCTAGCCGATCCGACCAACACTACCCTTGTCGTCGGAGCCGATTCAGTCTTGATGCTCACACCC
AACGTCACCCTCTTCGCGTCGGGAAACTATTACCGGCTCAACATGACTGTGCCCGTCGGCGAACTGGTCGAGCTA
ACCTTATGGGGCTGCAAAAAACAGACCTTTGCTTCGGTTAAGCGCCCAGGGGACTTGGGCTCCCCTAAGGAGGAG
GAGTTCCTCGTGAAGATGGGCATCGATGGCCAGCGGTTCCATTGGGACGTCATGGCCATCGAAGCACCCATAGAG
GAGGTGACGGGATGGAACGGCGAGCTATTCTGGATGCGCTTGACACGCCTGGCATGA
Gene >Ophio5|973
ATGAAGGTGGAAGCCGCGCTACTCTGGGCGGGATTCGGTAAGAGTCAGCCCAATACCGCTTTCTAGGCCGCCTAC
AACGGCAGCGTAGCCCGCTCAACGGTCTCCAGCTGTGGGCGTTGCCCTCGCGAACCTTCCGGGAATCCCTTCAGC
GCCCTACACCCCGTTGGGGTCGGGCATCTTCCCCATTTCCAGGATAGAGATTATTGGCGTCGACGCTCGACATGC
CTCTGTTCGAAATCAGCATGGAGCGACCCTGATTCCTCCCACGCTTCGAGACTTCGCCATTACCTTCGGTCGCGA
CCTCGAAGCTGTCTATGGCGTCCAAGCCGAAGTGATTGAGCATCGTGGCGCCGTCAGCCGCCGGAAGGGCGTCTT
TTTGACTCTGGATGACGGTCCGGGCTACACTGACGCCGCAGGACGACACACGTTCGAGGGCTACTCCCTGGTTAC
CAACCGCTCGGGCATCTTCATTGCCGGCGCCAGCCCGCTCGGTGTCTGGTGGGGGACTCGGACGGTTCTGCAGCA
GGCTGCCTTGTACGGGCGCATACCCCATGGCGAAGGCCAAGATTCGCCGGCCTGGGGAGAGCGCGGCATGATGCT
TGACGCAGGCCGGCATTACTATCCCAAGAGCTTCCTCATCGAAATGTGTTCTTACATGTCCTTCTTCAAGCAAAA
TGTCTTTCATCTGCATTTGAGCGACAACTTACACAATAGTAAGGCTTACTCTGCGGAGCAGTCGCTCCGCCTCGG
CGCCTGGTTCCGTCTCTGGTCCGACAACAAGGAGCTGAGCGGGCTTAGCAGGCACCGCAATGAGTCGTACACAAG
GGCCGACTTTGACGAAATTCAGAAGGCTTGCGCAGATCGTGGCGTCACCGTCGTGCCGGAGATTGAGGCGCCCGG
TCATGCACTATCTATTGTCCAGTGGCGCCCACAGCTGGGACTCGAGGACCTGAGCCTCCTCGACATATCCCATCC
GCAGACGATGCCGACTATGAAGCTGATCTGGCGCGAGTTCTTGCCGTGGTTTCATTCCAAGGTTGTCTCCATCGG
GGCTGACGAGTACGGAGGACCGGTAAGCGATTATAACTGGTTCGTCAACTCGATGAACACCTTCATCCGTCAGTC
ATCCAACAAATCTATCCGTATTTGGGGCACCTTCCCACCAAAACCGAGCTACCACATCAACATTGATCAAGACGT
TTCCATTCAGCATTGGAGTTACCACGAGGACAACCCATACCACGACTATATTCGCAAAGACTACTCCGTTGTCAA
CTCCATGGGCGATTTCTACGTTGTCAACAAATGGGGCCGCTACCCAAACACCATCGACATCTCCAAGACCTTTCA
CGGCGACCCCTCCATCCGGGGCAAGGGACCCTGGCATCCTCACATCTTCAACATGAAGAATGCATCGGACAACCC
CAGACGTAACGAGCCCCTGGTGCTCGGGGCCATCGCGCCGCTATGGAACGACTACGGGCCCAACGCGAGTGTCTA
CTCCGAAGCGTACTACGCATGGCGTCTGGGCTTGCCGGCGTTGGCGGATAAGCAATGGGGTGGTAAGCTGACCAA
ACAGCAGTTCGATTTCTATTTCCGTAAACTCCATTCACGCATCCCGGCACAAAACCTCGACAGAAACATTCCATC
TAAGGGGGTCGTCATCTTTGAGTACGACTTAAGCCGTGGCAACAACGTCTCTCACGGGCTCGTAAAGGATCTGAC
GACAAACGGTTATGACGCCAGCACGAAGTGCGCATTCCGAGACTCGTCTCTTCTCATCACGCCAAGATGCGCCTT
GGTGACACCATGGCGATCCAAGGGCAGAGACTACACCCTGTCCCTGAAGCTCAAAATTAGCCAGCTAGCCGATCC
GACCAACACTACCCTTGTCGTCGGAGCCGATTCAGTCTTGATGCTCACACCCAACGTCACCCTCTTCGCGTCGGG
AAACTATTACCGGCTCAACATGACTGTGCCCGTCGGCGAACTGGTCGAGCTAACCTTATGGGGCTGCAAAAAACA
GACCTTTGCTTCGGTTAAGCGCCCAGGGGACTTGGGCTCCCCTAAGGAGGAGGAGTTCCTCGTGAAGATGGGCAT
CGATGGCCAGCGGTTCCATTGGGACGTCATGGCCATCGAAGCACCCATAGAGGAGGTGACGGGATGGAACGGCGA
GCTATTCTGGATGCGCTTGACACGCCTGGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail