Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|970
Gene name
Locationscaffold_13:660..2061
Strand-
Gene length (bp)1401
Transcript length (bp)1401
Coding sequence length (bp)1398
Protein length (aa) 466

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20150 2EXR 2EXR family 1.6E-10 55 161

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2468 0.9353 0.0627 0.0536 0.0694 0.0063 0.0165 0.0346 0.0129 0.0184

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2156
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6376
Ophiocordyceps australis map64 (Brazil) OphauB2|7595
Ophiocordyceps camponoti-floridani Ophcf2|02542
Ophiocordyceps camponoti-rufipedis Ophun1|3602
Ophiocordyceps kimflemingae Ophio5|970 (this protein)
Ophiocordyceps subramaniannii Hirsu2|265

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|970
MVKRRDSWLQEWQPLSISRRPRAVPPVTDFCDLEAQESSECETDSDDSYSTETSFPRFMQLPLELRIRVWEIFCP
DLKAKARFLRCTILPAWENPPARDVRHLHVTYQVEDQTRPLRSVMAVHRESRRLAEAVYPHTLPVKADYDGKQGA
SLAFNQLSDVIFIECLPTSSNASMDFTIPAYETTSILNIAIQCSQEVKTFSAETIEGYIPSWLRIFPNVTRLYLW
MEDYCIPTRRIRWAVSDSAHQVLVATSEKTSGIGEDTEVVCCWPDVDTYPDFEITQDFKPFMPEEVVHRMRKRGV
EMIPLVSFEFQESVDRYRYLLATKDGPYIDDSDENSDRLSDDSIDDEYESEGIDDDPLDESDIEDGDEEGGLDDT
NSIEGEVYEEGNWDNSPQADSEPSEARFSSPELDEQEPQRRTQKRRIVIDSDDSGDDEARVKRPRQARRVVADSD
SDEPLPTGSLCRLGPA
Coding >Ophio5|970
ATGGTCAAGCGTCGTGACTCATGGCTGCAGGAATGGCAGCCTCTCTCCATATCCAGACGCCCCCGGGCCGTGCCT
CCCGTCACCGACTTCTGCGACCTCGAGGCTCAAGAGTCCAGCGAGTGCGAAACCGACAGTGACGATTCTTACAGC
ACTGAGACCTCATTTCCCCGCTTCATGCAGCTTCCGCTTGAGCTTCGAATTCGTGTCTGGGAGATTTTCTGCCCA
GACCTCAAAGCCAAGGCTCGCTTCTTACGCTGTACCATCTTGCCAGCTTGGGAAAATCCGCCAGCCCGCGACGTG
CGCCATCTCCACGTTACCTATCAGGTTGAAGATCAGACACGGCCTCTGCGATCCGTTATGGCCGTTCATCGCGAG
TCGCGCCGCCTGGCCGAGGCCGTCTATCCGCACACGCTTCCCGTTAAGGCCGATTATGATGGTAAACAGGGCGCT
TCTTTAGCCTTCAACCAGCTGTCCGACGTCATATTCATCGAATGCCTTCCGACCAGTTCCAACGCGTCTATGGAC
TTCACTATACCGGCATATGAGACCACCTCCATCCTGAATATTGCCATTCAATGCTCGCAGGAGGTTAAAACCTTT
AGTGCCGAAACCATTGAAGGGTATATACCAAGTTGGCTGAGAATATTTCCCAATGTGACGAGGCTTTACCTCTGG
ATGGAAGACTATTGCATCCCAACAAGAAGAATACGTTGGGCCGTTTCTGATAGCGCCCATCAAGTTCTGGTTGCA
ACCTCTGAGAAAACGTCTGGTATTGGCGAAGACACGGAGGTTGTTTGCTGTTGGCCCGACGTCGACACGTATCCC
GACTTCGAGATCACCCAAGACTTCAAGCCGTTCATGCCTGAAGAAGTCGTTCACAGGATGCGCAAGCGTGGCGTC
GAGATGATACCATTAGTCTCCTTCGAATTTCAAGAGTCGGTAGATCGCTATAGGTATCTACTAGCTACTAAGGAC
GGACCCTATATCGACGACTCCGATGAAAATTCAGACAGATTGTCTGATGACTCTATTGACGACGAGTACGAGAGT
GAGGGCATAGACGATGACCCCCTAGACGAAAGCGACATTGAAGATGGCGACGAGGAAGGAGGCCTAGACGATACT
AATTCTATCGAAGGAGAGGTTTATGAGGAGGGTAATTGGGATAATTCTCCTCAAGCTGATAGCGAGCCGTCAGAA
GCCAGGTTCTCGAGCCCCGAGCTGGATGAGCAAGAGCCTCAACGACGCACCCAAAAGCGGAGAATCGTTATTGAC
TCCGACGATTCCGGCGACGACGAGGCGAGAGTTAAGCGCCCTCGGCAGGCCCGTCGCGTCGTCGCAGACTCCGAC
TCAGACGAACCACTCCCTACCGGGTCTTTGTGTCGCCTCGGCCCAGCC
Transcript >Ophio5|970
ATGGTCAAGCGTCGTGACTCATGGCTGCAGGAATGGCAGCCTCTCTCCATATCCAGACGCCCCCGGGCCGTGCCT
CCCGTCACCGACTTCTGCGACCTCGAGGCTCAAGAGTCCAGCGAGTGCGAAACCGACAGTGACGATTCTTACAGC
ACTGAGACCTCATTTCCCCGCTTCATGCAGCTTCCGCTTGAGCTTCGAATTCGTGTCTGGGAGATTTTCTGCCCA
GACCTCAAAGCCAAGGCTCGCTTCTTACGCTGTACCATCTTGCCAGCTTGGGAAAATCCGCCAGCCCGCGACGTG
CGCCATCTCCACGTTACCTATCAGGTTGAAGATCAGACACGGCCTCTGCGATCCGTTATGGCCGTTCATCGCGAG
TCGCGCCGCCTGGCCGAGGCCGTCTATCCGCACACGCTTCCCGTTAAGGCCGATTATGATGGTAAACAGGGCGCT
TCTTTAGCCTTCAACCAGCTGTCCGACGTCATATTCATCGAATGCCTTCCGACCAGTTCCAACGCGTCTATGGAC
TTCACTATACCGGCATATGAGACCACCTCCATCCTGAATATTGCCATTCAATGCTCGCAGGAGGTTAAAACCTTT
AGTGCCGAAACCATTGAAGGGTATATACCAAGTTGGCTGAGAATATTTCCCAATGTGACGAGGCTTTACCTCTGG
ATGGAAGACTATTGCATCCCAACAAGAAGAATACGTTGGGCCGTTTCTGATAGCGCCCATCAAGTTCTGGTTGCA
ACCTCTGAGAAAACGTCTGGTATTGGCGAAGACACGGAGGTTGTTTGCTGTTGGCCCGACGTCGACACGTATCCC
GACTTCGAGATCACCCAAGACTTCAAGCCGTTCATGCCTGAAGAAGTCGTTCACAGGATGCGCAAGCGTGGCGTC
GAGATGATACCATTAGTCTCCTTCGAATTTCAAGAGTCGGTAGATCGCTATAGGTATCTACTAGCTACTAAGGAC
GGACCCTATATCGACGACTCCGATGAAAATTCAGACAGATTGTCTGATGACTCTATTGACGACGAGTACGAGAGT
GAGGGCATAGACGATGACCCCCTAGACGAAAGCGACATTGAAGATGGCGACGAGGAAGGAGGCCTAGACGATACT
AATTCTATCGAAGGAGAGGTTTATGAGGAGGGTAATTGGGATAATTCTCCTCAAGCTGATAGCGAGCCGTCAGAA
GCCAGGTTCTCGAGCCCCGAGCTGGATGAGCAAGAGCCTCAACGACGCACCCAAAAGCGGAGAATCGTTATTGAC
TCCGACGATTCCGGCGACGACGAGGCGAGAGTTAAGCGCCCTCGGCAGGCCCGTCGCGTCGTCGCAGACTCCGAC
TCAGACGAACCACTCCCTACCGGGTCTTTGTGTCGCCTCGGCCCAGCCTAA
Gene >Ophio5|970
ATGGTCAAGCGTCGTGACTCATGGCTGCAGGAATGGCAGCCTCTCTCCATATCCAGACGCCCCCGGGCCGTGCCT
CCCGTCACCGACTTCTGCGACCTCGAGGCTCAAGAGTCCAGCGAGTGCGAAACCGACAGTGACGATTCTTACAGC
ACTGAGACCTCATTTCCCCGCTTCATGCAGCTTCCGCTTGAGCTTCGAATTCGTGTCTGGGAGATTTTCTGCCCA
GACCTCAAAGCCAAGGCTCGCTTCTTACGCTGTACCATCTTGCCAGCTTGGGAAAATCCGCCAGCCCGCGACGTG
CGCCATCTCCACGTTACCTATCAGGTTGAAGATCAGACACGGCCTCTGCGATCCGTTATGGCCGTTCATCGCGAG
TCGCGCCGCCTGGCCGAGGCCGTCTATCCGCACACGCTTCCCGTTAAGGCCGATTATGATGGTAAACAGGGCGCT
TCTTTAGCCTTCAACCAGCTGTCCGACGTCATATTCATCGAATGCCTTCCGACCAGTTCCAACGCGTCTATGGAC
TTCACTATACCGGCATATGAGACCACCTCCATCCTGAATATTGCCATTCAATGCTCGCAGGAGGTTAAAACCTTT
AGTGCCGAAACCATTGAAGGGTATATACCAAGTTGGCTGAGAATATTTCCCAATGTGACGAGGCTTTACCTCTGG
ATGGAAGACTATTGCATCCCAACAAGAAGAATACGTTGGGCCGTTTCTGATAGCGCCCATCAAGTTCTGGTTGCA
ACCTCTGAGAAAACGTCTGGTATTGGCGAAGACACGGAGGTTGTTTGCTGTTGGCCCGACGTCGACACGTATCCC
GACTTCGAGATCACCCAAGACTTCAAGCCGTTCATGCCTGAAGAAGTCGTTCACAGGATGCGCAAGCGTGGCGTC
GAGATGATACCATTAGTCTCCTTCGAATTTCAAGAGTCGGTAGATCGCTATAGGTATCTACTAGCTACTAAGGAC
GGACCCTATATCGACGACTCCGATGAAAATTCAGACAGATTGTCTGATGACTCTATTGACGACGAGTACGAGAGT
GAGGGCATAGACGATGACCCCCTAGACGAAAGCGACATTGAAGATGGCGACGAGGAAGGAGGCCTAGACGATACT
AATTCTATCGAAGGAGAGGTTTATGAGGAGGGTAATTGGGATAATTCTCCTCAAGCTGATAGCGAGCCGTCAGAA
GCCAGGTTCTCGAGCCCCGAGCTGGATGAGCAAGAGCCTCAACGACGCACCCAAAAGCGGAGAATCGTTATTGAC
TCCGACGATTCCGGCGACGACGAGGCGAGAGTTAAGCGCCCTCGGCAGGCCCGTCGCGTCGTCGCAGACTCCGAC
TCAGACGAACCACTCCCTACCGGGTCTTTGTGTCGCCTCGGCCCAGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail