Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|969
Gene name
Locationscaffold_1299:119..2033
Strand-
Gene length (bp)1914
Transcript length (bp)1914
Coding sequence length (bp)1911
Protein length (aa) 637

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02902 Peptidase_C48 Ulp1 protease family, C-terminal catalytic domain 3.1E-18 441 622

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42957|ULP1_SCHPO Ubiquitin-like-specific protease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ulp1 PE=3 SV=1 440 626 2.0E-17
sp|Q94F30|ESD4_ARATH Ubiquitin-like-specific protease ESD4 OS=Arabidopsis thaliana GN=ESD4 PE=1 SV=1 346 624 2.0E-14
sp|Q09353|SENP_CAEEL Sentrin-specific protease OS=Caenorhabditis elegans GN=ulp-1 PE=2 SV=3 429 625 5.0E-13
sp|Q9EQE1|SENP2_RAT Sentrin-specific protease 2 OS=Rattus norvegicus GN=Senp2 PE=1 SV=1 427 625 1.0E-12
sp|P59110|SENP1_MOUSE Sentrin-specific protease 1 OS=Mus musculus GN=Senp1 PE=2 SV=1 441 625 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42957|ULP1_SCHPO Ubiquitin-like-specific protease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ulp1 PE=3 SV=1 440 626 2.0E-17
sp|Q94F30|ESD4_ARATH Ubiquitin-like-specific protease ESD4 OS=Arabidopsis thaliana GN=ESD4 PE=1 SV=1 346 624 2.0E-14
sp|Q09353|SENP_CAEEL Sentrin-specific protease OS=Caenorhabditis elegans GN=ulp-1 PE=2 SV=3 429 625 5.0E-13
sp|Q9EQE1|SENP2_RAT Sentrin-specific protease 2 OS=Rattus norvegicus GN=Senp2 PE=1 SV=1 427 625 1.0E-12
sp|P59110|SENP1_MOUSE Sentrin-specific protease 1 OS=Mus musculus GN=Senp1 PE=2 SV=1 441 625 2.0E-12
sp|Q02724|ULP1_YEAST Ubiquitin-like-specific protease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULP1 PE=1 SV=1 431 614 4.0E-12
sp|Q9P0U3|SENP1_HUMAN Sentrin-specific protease 1 OS=Homo sapiens GN=SENP1 PE=1 SV=2 441 625 8.0E-12
sp|Q5RBB1|SENP1_PONAB Sentrin-specific protease 1 OS=Pongo abelii GN=SENP1 PE=2 SV=1 441 625 9.0E-12
sp|Q91ZX6|SENP2_MOUSE Sentrin-specific protease 2 OS=Mus musculus GN=Senp2 PE=1 SV=2 427 625 1.0E-11
sp|Q5R7K7|SENP2_PONAB Sentrin-specific protease 2 OS=Pongo abelii GN=SENP2 PE=2 SV=1 427 625 2.0E-11
sp|Q9HC62|SENP2_HUMAN Sentrin-specific protease 2 OS=Homo sapiens GN=SENP2 PE=1 SV=3 427 625 2.0E-11
sp|Q8WP32|SENP5_MACFA Sentrin-specific protease 5 OS=Macaca fascicularis GN=SENP5 PE=2 SV=1 431 619 4.0E-11
sp|Q96HI0|SENP5_HUMAN Sentrin-specific protease 5 OS=Homo sapiens GN=SENP5 PE=1 SV=3 431 619 6.0E-11
sp|Q6NXL6|SENP5_MOUSE Sentrin-specific protease 5 OS=Mus musculus GN=Senp5 PE=2 SV=1 431 625 7.0E-11
sp|Q8GYL3|ULP1A_ARATH Ubiquitin-like-specific protease 1A OS=Arabidopsis thaliana GN=ULP1A PE=2 SV=2 440 624 1.0E-10
sp|Q9H4L4|SENP3_HUMAN Sentrin-specific protease 3 OS=Homo sapiens GN=SENP3 PE=1 SV=2 319 619 9.0E-08
sp|Q9EP97|SENP3_MOUSE Sentrin-specific protease 3 OS=Mus musculus GN=Senp3 PE=1 SV=1 431 619 9.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0008234 cysteine-type peptidase activity Yes
GO:0006508 proteolysis Yes
GO:0016787 hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0008233 peptidase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5077 0.5643 0.3773 0.0896 0.1988 0.2595 0.1502 0.1366 0.0933 0.0883

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5136
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3335
Ophiocordyceps camponoti-floridani Ophcf2|04285
Ophiocordyceps camponoti-rufipedis Ophun1|2103
Ophiocordyceps kimflemingae Ophio5|969 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3497

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|969
MLCGLPIPSFVVQICGLFPPPARIELGRQCRLPGSFPQECHDELAIQKTEEDSFGAAQNDETASAAVALRRVPSA
PPDFAEAVIDKHRADYIEWRISEMTAQNIRRHFYNESDFHRAIRTAYNADFVPKTPIKFVRKPRTILRKGPRQIT
RYNPKRLALTRPSRAVRCTNKRISPHPGTHTGLDVPGLLGIDTERKSPDDPFFAVGREHSFHVSSDNSIRLTRSL
GASWHADDAWYKPEKKFETPELDLPIFYDTEKRGNVREWTARVKAEAPARIHELVNAPALEGLANEPIEEILQRL
VKKGQVDTTHRDRYRAARQEAAEQAEKKAEEEARRLVEDACRRAEEAAKRLAEEEAKRLAEEEELAAERREAEQK
LTEESFSVARGLRLPRRPLVFPPSKVWIDLAHSTLRATASRTLAKTSEGSDLRRHDFATVVPSTQWLNDEIINGS
LLWMDKAINEAAGIEDVRRQTRKCLTLNSFFFKDLLNKGPCGTERKLRRCGVNKNNFLDVETVLLPICDRSHWTM
LVVRPGRRCVMHLDSLNSQGSSAFTTLTLLWLKEVLQEKFVASEWTVVKEQIPVQMNGHDCGVFAITNAICLALG
LSPVHSYTAADMPMQRIRIACMLLNGGFSGDFDLGVH
Coding >Ophio5|969
ATGCTATGTGGCCTACCCATCCCAAGCTTTGTCGTTCAGATCTGCGGGCTCTTCCCGCCCCCTGCGCGCATCGAG
CTAGGCCGGCAATGTCGCCTCCCGGGATCCTTTCCGCAGGAATGTCATGATGAGCTCGCTATACAAAAAACTGAA
GAGGATAGTTTCGGAGCTGCGCAAAATGACGAGACTGCATCGGCTGCCGTCGCACTGCGGCGGGTTCCTAGTGCG
CCGCCGGACTTTGCAGAGGCTGTGATAGACAAACACCGGGCCGACTACATAGAGTGGAGGATCTCTGAGATGACA
GCTCAAAATATCCGTCGCCATTTTTACAACGAGAGCGACTTTCATCGCGCCATCCGGACTGCCTACAACGCCGAT
TTCGTGCCGAAGACGCCGATTAAATTTGTCCGGAAACCGAGAACGATTCTCAGGAAAGGCCCCAGACAGATCACG
CGATATAATCCCAAGCGTCTGGCATTGACCCGACCTTCCAGGGCTGTGCGGTGTACGAACAAAAGGATTAGTCCC
CATCCGGGGACTCACACAGGATTGGATGTCCCAGGGTTGCTAGGGATCGACACTGAACGCAAAAGTCCTGATGAC
CCTTTCTTCGCAGTTGGACGGGAACACTCTTTTCATGTTTCTTCAGACAACAGCATCAGGCTCACAAGATCGCTG
GGAGCCTCATGGCACGCTGATGACGCTTGGTACAAACCCGAGAAGAAATTCGAGACACCTGAGTTGGATTTGCCA
ATCTTCTATGATACTGAGAAAAGGGGAAATGTGAGGGAGTGGACAGCTCGTGTTAAGGCTGAGGCACCAGCTCGG
ATTCATGAGTTGGTTAATGCTCCAGCTCTCGAGGGGCTTGCGAATGAGCCCATCGAAGAGATTCTCCAGAGATTG
GTCAAGAAAGGCCAAGTGGATACGACCCACCGAGATCGTTACCGCGCGGCCAGGCAAGAGGCTGCAGAACAGGCT
GAAAAAAAGGCCGAGGAGGAGGCCAGGCGCCTGGTCGAAGACGCCTGCCGCCGCGCTGAAGAGGCGGCGAAACGC
CTGGCGGAAGAAGAGGCGAAACGACTGGCGGAAGAAGAAGAACTTGCCGCGGAGAGACGCGAAGCCGAGCAGAAG
CTTACCGAAGAGAGCTTCTCCGTGGCCCGAGGCCTTCGTCTCCCCCGTCGTCCGCTCGTGTTTCCTCCAAGCAAG
GTGTGGATTGATTTGGCACACAGTACTTTGAGGGCTACCGCTTCGAGGACGCTCGCCAAGACCAGTGAAGGCAGT
GATTTGAGACGACACGATTTCGCCACGGTCGTCCCATCAACACAATGGCTTAATGACGAGATCATCAATGGCTCC
CTTCTCTGGATGGACAAGGCTATCAATGAGGCGGCTGGTATTGAGGATGTCAGGAGGCAGACTCGCAAATGTTTA
ACCTTGAACTCTTTCTTCTTCAAGGATCTACTCAACAAGGGTCCCTGTGGAACTGAACGGAAGCTCCGACGCTGC
GGTGTGAACAAAAACAATTTCTTGGACGTCGAGACGGTTCTGCTACCGATTTGCGATCGATCTCACTGGACGATG
CTCGTCGTTCGACCTGGCCGGAGATGTGTGATGCATCTTGATTCTCTCAACTCACAAGGATCATCAGCTTTCACA
ACTCTTACCTTACTATGGCTCAAAGAAGTCTTGCAAGAGAAATTTGTTGCCTCGGAATGGACCGTTGTTAAGGAG
CAAATACCTGTACAGATGAATGGGCACGATTGCGGCGTATTCGCCATCACTAATGCTATTTGCTTGGCCCTGGGC
TTGAGCCCTGTTCACAGCTACACTGCGGCCGACATGCCGATGCAACGCATACGCATTGCCTGCATGCTACTGAAT
GGCGGCTTCTCAGGCGATTTCGACTTGGGGGTGCAC
Transcript >Ophio5|969
ATGCTATGTGGCCTACCCATCCCAAGCTTTGTCGTTCAGATCTGCGGGCTCTTCCCGCCCCCTGCGCGCATCGAG
CTAGGCCGGCAATGTCGCCTCCCGGGATCCTTTCCGCAGGAATGTCATGATGAGCTCGCTATACAAAAAACTGAA
GAGGATAGTTTCGGAGCTGCGCAAAATGACGAGACTGCATCGGCTGCCGTCGCACTGCGGCGGGTTCCTAGTGCG
CCGCCGGACTTTGCAGAGGCTGTGATAGACAAACACCGGGCCGACTACATAGAGTGGAGGATCTCTGAGATGACA
GCTCAAAATATCCGTCGCCATTTTTACAACGAGAGCGACTTTCATCGCGCCATCCGGACTGCCTACAACGCCGAT
TTCGTGCCGAAGACGCCGATTAAATTTGTCCGGAAACCGAGAACGATTCTCAGGAAAGGCCCCAGACAGATCACG
CGATATAATCCCAAGCGTCTGGCATTGACCCGACCTTCCAGGGCTGTGCGGTGTACGAACAAAAGGATTAGTCCC
CATCCGGGGACTCACACAGGATTGGATGTCCCAGGGTTGCTAGGGATCGACACTGAACGCAAAAGTCCTGATGAC
CCTTTCTTCGCAGTTGGACGGGAACACTCTTTTCATGTTTCTTCAGACAACAGCATCAGGCTCACAAGATCGCTG
GGAGCCTCATGGCACGCTGATGACGCTTGGTACAAACCCGAGAAGAAATTCGAGACACCTGAGTTGGATTTGCCA
ATCTTCTATGATACTGAGAAAAGGGGAAATGTGAGGGAGTGGACAGCTCGTGTTAAGGCTGAGGCACCAGCTCGG
ATTCATGAGTTGGTTAATGCTCCAGCTCTCGAGGGGCTTGCGAATGAGCCCATCGAAGAGATTCTCCAGAGATTG
GTCAAGAAAGGCCAAGTGGATACGACCCACCGAGATCGTTACCGCGCGGCCAGGCAAGAGGCTGCAGAACAGGCT
GAAAAAAAGGCCGAGGAGGAGGCCAGGCGCCTGGTCGAAGACGCCTGCCGCCGCGCTGAAGAGGCGGCGAAACGC
CTGGCGGAAGAAGAGGCGAAACGACTGGCGGAAGAAGAAGAACTTGCCGCGGAGAGACGCGAAGCCGAGCAGAAG
CTTACCGAAGAGAGCTTCTCCGTGGCCCGAGGCCTTCGTCTCCCCCGTCGTCCGCTCGTGTTTCCTCCAAGCAAG
GTGTGGATTGATTTGGCACACAGTACTTTGAGGGCTACCGCTTCGAGGACGCTCGCCAAGACCAGTGAAGGCAGT
GATTTGAGACGACACGATTTCGCCACGGTCGTCCCATCAACACAATGGCTTAATGACGAGATCATCAATGGCTCC
CTTCTCTGGATGGACAAGGCTATCAATGAGGCGGCTGGTATTGAGGATGTCAGGAGGCAGACTCGCAAATGTTTA
ACCTTGAACTCTTTCTTCTTCAAGGATCTACTCAACAAGGGTCCCTGTGGAACTGAACGGAAGCTCCGACGCTGC
GGTGTGAACAAAAACAATTTCTTGGACGTCGAGACGGTTCTGCTACCGATTTGCGATCGATCTCACTGGACGATG
CTCGTCGTTCGACCTGGCCGGAGATGTGTGATGCATCTTGATTCTCTCAACTCACAAGGATCATCAGCTTTCACA
ACTCTTACCTTACTATGGCTCAAAGAAGTCTTGCAAGAGAAATTTGTTGCCTCGGAATGGACCGTTGTTAAGGAG
CAAATACCTGTACAGATGAATGGGCACGATTGCGGCGTATTCGCCATCACTAATGCTATTTGCTTGGCCCTGGGC
TTGAGCCCTGTTCACAGCTACACTGCGGCCGACATGCCGATGCAACGCATACGCATTGCCTGCATGCTACTGAAT
GGCGGCTTCTCAGGCGATTTCGACTTGGGGGTGCACTAG
Gene >Ophio5|969
ATGCTATGTGGCCTACCCATCCCAAGCTTTGTCGTTCAGATCTGCGGGCTCTTCCCGCCCCCTGCGCGCATCGAG
CTAGGCCGGCAATGTCGCCTCCCGGGATCCTTTCCGCAGGAATGTCATGATGAGCTCGCTATACAAAAAACTGAA
GAGGATAGTTTCGGAGCTGCGCAAAATGACGAGACTGCATCGGCTGCCGTCGCACTGCGGCGGGTTCCTAGTGCG
CCGCCGGACTTTGCAGAGGCTGTGATAGACAAACACCGGGCCGACTACATAGAGTGGAGGATCTCTGAGATGACA
GCTCAAAATATCCGTCGCCATTTTTACAACGAGAGCGACTTTCATCGCGCCATCCGGACTGCCTACAACGCCGAT
TTCGTGCCGAAGACGCCGATTAAATTTGTCCGGAAACCGAGAACGATTCTCAGGAAAGGCCCCAGACAGATCACG
CGATATAATCCCAAGCGTCTGGCATTGACCCGACCTTCCAGGGCTGTGCGGTGTACGAACAAAAGGATTAGTCCC
CATCCGGGGACTCACACAGGATTGGATGTCCCAGGGTTGCTAGGGATCGACACTGAACGCAAAAGTCCTGATGAC
CCTTTCTTCGCAGTTGGACGGGAACACTCTTTTCATGTTTCTTCAGACAACAGCATCAGGCTCACAAGATCGCTG
GGAGCCTCATGGCACGCTGATGACGCTTGGTACAAACCCGAGAAGAAATTCGAGACACCTGAGTTGGATTTGCCA
ATCTTCTATGATACTGAGAAAAGGGGAAATGTGAGGGAGTGGACAGCTCGTGTTAAGGCTGAGGCACCAGCTCGG
ATTCATGAGTTGGTTAATGCTCCAGCTCTCGAGGGGCTTGCGAATGAGCCCATCGAAGAGATTCTCCAGAGATTG
GTCAAGAAAGGCCAAGTGGATACGACCCACCGAGATCGTTACCGCGCGGCCAGGCAAGAGGCTGCAGAACAGGCT
GAAAAAAAGGCCGAGGAGGAGGCCAGGCGCCTGGTCGAAGACGCCTGCCGCCGCGCTGAAGAGGCGGCGAAACGC
CTGGCGGAAGAAGAGGCGAAACGACTGGCGGAAGAAGAAGAACTTGCCGCGGAGAGACGCGAAGCCGAGCAGAAG
CTTACCGAAGAGAGCTTCTCCGTGGCCCGAGGCCTTCGTCTCCCCCGTCGTCCGCTCGTGTTTCCTCCAAGCAAG
GTGTGGATTGATTTGGCACACAGTACTTTGAGGGCTACCGCTTCGAGGACGCTCGCCAAGACCAGTGAAGGCAGT
GATTTGAGACGACACGATTTCGCCACGGTCGTCCCATCAACACAATGGCTTAATGACGAGATCATCAATGGCTCC
CTTCTCTGGATGGACAAGGCTATCAATGAGGCGGCTGGTATTGAGGATGTCAGGAGGCAGACTCGCAAATGTTTA
ACCTTGAACTCTTTCTTCTTCAAGGATCTACTCAACAAGGGTCCCTGTGGAACTGAACGGAAGCTCCGACGCTGC
GGTGTGAACAAAAACAATTTCTTGGACGTCGAGACGGTTCTGCTACCGATTTGCGATCGATCTCACTGGACGATG
CTCGTCGTTCGACCTGGCCGGAGATGTGTGATGCATCTTGATTCTCTCAACTCACAAGGATCATCAGCTTTCACA
ACTCTTACCTTACTATGGCTCAAAGAAGTCTTGCAAGAGAAATTTGTTGCCTCGGAATGGACCGTTGTTAAGGAG
CAAATACCTGTACAGATGAATGGGCACGATTGCGGCGTATTCGCCATCACTAATGCTATTTGCTTGGCCCTGGGC
TTGAGCCCTGTTCACAGCTACACTGCGGCCGACATGCCGATGCAACGCATACGCATTGCCTGCATGCTACTGAAT
GGCGGCTTCTCAGGCGATTTCGACTTGGGGGTGCACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail