Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|955
Gene name
Locationscaffold_129:23047..28707
Strand-
Gene length (bp)5660
Transcript length (bp)5541
Coding sequence length (bp)5538
Protein length (aa) 1846

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.0E-06 1394 1461

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6497 0.5194 0.1915 0.1371 0.3997 0.0852 0.0735 0.2428 0.2337 0.0292

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2927
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7618
Ophiocordyceps australis map64 (Brazil) OphauB2|7198
Ophiocordyceps camponoti-floridani Ophcf2|06319
Ophiocordyceps camponoti-rufipedis Ophun1|3012
Ophiocordyceps kimflemingae Ophio5|955 (this protein)
Ophiocordyceps subramaniannii Hirsu2|4910

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|955
MTTATTADRQRRLVQLCEHWGIAPLQAFPPLPPATPPPSFRTPADDQLADDFLQRRAADTAHLRPKGVIRQAFSS
AGLRKGKTWDPSHVLDALTTWVANAGSPGVAEVLAAKLVAAGVHLVDTQRQKGSGILNKRHSLEPHDVRVRLLRL
AVVAKNIQLAQVLLPYAEPAVLDACLPYAIRGGDTAMTELLLVQGASAAYSREGQDAFRQACTIHGHSQLVSLVL
RSVRHPEPMWTSTAMCDAARAGCFDAVLLLSHSTADGNHNQAEALRSAVCSGRQDIALAIVIGNNPPQRPALNNA
LNTIQRDSSLEPVIKLKLVEILLCAGAGGVMVSQILETYYQAEFLEMATLLAEYGAAAEYDDGAVLKSAITRGQL
ALVTSFLRLPCAISPTLASACMSLIPKEASFELRHAILSLLLRQGATGAALDQMLIDAAKTGDVKSVDLLLTPFF
PAVSPRSSTARRSSSPKKHAVAEVDYNSGEALRAALLRADLQMTRKILSRQPSQTTLAAVFPLTKQLDREDRCQM
TELFLQSSLLPGPCLQAALVEAVNDQSPDRDLHLIKLLLKYDADVSFSHGTGLSSLIKEIDLELLDPLLQKVSPK
TAAAHLQDMIRVEDHLTRAHVAAMLLSAGADKDVDQVVETLLAVMSEDPVDLLLLDLLIQQGHADVNLSDGAIIK
KAVANPSPEVLELVINQGEPSTSSITRALRALMPLPSTEDKARKLETLLNRSTRKQDVNSMLVHEVKSVAQSSLE
SPSLSSLKHLLAAGADLNAHNAAALSHAVIGAKADVVRIMLDWRFPPAPTALGVALPHALRITESTKRLELTKAL
VQAGVLADEAGRALTFAISNFPKDLPLISVLAASADPTDGEALALSASKESPEIMDVVLTSSASSTEARSSALGL
VMAVQNNEVRGKMCRSLLAAGVSNDAASNALLFASRHADLELCHMLVARGAVKGSHGGQAVVEACRRGSAEVLSV
LLEACPDDDEEMLKAGFQAATEVGDLNKRAIIFEQLLGQGLSGDLVDAQLQSAARYGQDGMGVLKVLLASGADPN
YNNGDCVFSAASCAFVATLDLLLGLGTEENHQKKVSQPTLLRALGACWSLQPDTRYLIACSLFQAGLGACDDLHQ
TLNDAVNEEDPDERLVKLLLDHGASPAVHDCKSLKDAARSMATSTLALLLATELPEGRAEEAFEEAFSADNFDSW
FTHAGLGTARLLLDKAVDAEALSRALILVMKNSFTEARALADAFFDLLMARGPKIDHNGGELLRQAASMADQPWT
ARLLECHPSADTLSSAFQCIFNTETSQESVLDLFKMFTDYYEEDAEIDLVAGRQGYEPMVKRAINQYPRSTMVLE
TLLDAGFYHDQTTRCQIYPDSREDEEATLLLWAIAQPQKRVSTAVIKTLIERGAKVNGESSVSRTTPLMLATQTR
RLDLVKSLVDHGADGDAIDSQGRTSLCMAATAGGDVAVQLMTILLVAEPSKDDGSLHNAARNLNLPAVRLLVQAG
HDPDFPSPLHGGRSALGEVCLHGSDGGEMTALRERAMLKVMGLLMSGNSDLTIKSNDMPFLLLCFEAADPVVTTR
ALLKSGMWKHVNKPFNRFTFGDYTYSPTMYITKVMGPSSVNDQLLEVLRASRAMDMFYASEGPQPDGAVGLPEEV
EAEDRARKARLSRIAMESEDFSIAMACKRQLADVEQQIAAQQDEAEERRRRKLHGHDLAVIRSRHKATEAAAVAS
HERRIAEHQALAKASLGSARAMAETELEAEEARQRKALAWERQFNSARVGHVRALSTINLGEMQAVQRIEKDAHQ
RLEKRLLAQRLLVESQDKLAGRLGGARTAMIEDRKRPAVGYVTELD
Coding >Ophio5|955
ATGACAACCGCGACGACAGCTGATCGCCAGCGGCGCCTCGTTCAGCTCTGTGAGCATTGGGGCATCGCGCCTCTC
CAGGCGTTCCCTCCTCTTCCGCCTGCGACGCCGCCGCCGTCCTTTCGCACGCCGGCAGATGATCAACTGGCCGAT
GATTTTTTGCAGCGCCGCGCCGCTGATACCGCCCATCTTCGACCCAAGGGCGTTATTCGACAGGCTTTTTCCTCG
GCTGGCCTCCGAAAGGGAAAAACCTGGGATCCAAGCCATGTGCTTGACGCCTTGACCACTTGGGTGGCTAATGCT
GGCTCACCGGGCGTCGCTGAGGTTCTCGCCGCTAAGCTGGTTGCTGCGGGCGTCCATCTGGTCGACACGCAAAGG
CAAAAGGGTAGCGGCATCCTCAACAAACGTCACAGCCTCGAGCCTCATGATGTCCGCGTCCGGCTGCTTCGTCTC
GCTGTCGTCGCAAAGAACATACAGCTGGCGCAGGTCCTACTCCCTTATGCCGAACCCGCCGTTCTCGATGCCTGC
TTGCCGTACGCCATCCGCGGCGGAGACACGGCCATGACGGAGCTCCTCCTCGTCCAAGGCGCTAGTGCGGCCTAC
AGTCGCGAGGGCCAGGATGCCTTCCGTCAGGCCTGCACCATTCACGGCCACTCGCAGTTGGTCAGCCTTGTCCTT
CGCTCTGTTCGTCACCCCGAGCCGATGTGGACGTCGACAGCCATGTGTGACGCTGCTCGAGCCGGCTGCTTCGAT
GCCGTGTTGCTCCTCAGCCACTCCACGGCCGACGGAAACCATAACCAGGCCGAGGCGCTGCGGTCTGCCGTGTGC
TCGGGAAGACAAGACATCGCCCTGGCCATCGTCATCGGAAACAACCCGCCGCAGAGGCCCGCCCTCAACAATGCT
CTCAACACAATCCAGCGTGATTCTTCTCTCGAGCCGGTCATCAAGCTCAAGCTCGTCGAAATTCTGCTCTGCGCT
GGAGCGGGCGGCGTCATGGTCTCGCAGATACTCGAGACCTACTACCAGGCTGAGTTTCTCGAAATGGCCACCTTG
CTGGCCGAGTACGGTGCGGCGGCCGAGTACGATGATGGAGCCGTACTCAAGTCGGCCATCACTCGCGGACAGCTG
GCTCTCGTAACGTCCTTTCTCCGCCTGCCGTGCGCCATCAGCCCTACCTTGGCGTCGGCTTGCATGTCTCTCATA
CCCAAAGAGGCTTCGTTCGAGCTGCGTCATGCGATTCTCAGCCTCCTCCTGCGGCAAGGCGCCACTGGAGCAGCT
CTCGACCAGATGCTCATCGACGCAGCAAAGACAGGCGACGTCAAGTCGGTCGATCTGCTGCTCACCCCTTTCTTT
CCCGCAGTCTCGCCACGCAGCTCGACGGCTCGACGGTCGTCTAGTCCCAAAAAGCACGCGGTAGCGGAAGTCGAC
TACAACTCTGGCGAGGCTCTCCGCGCTGCCCTGCTCCGCGCAGACTTGCAGATGACGCGCAAGATCCTCTCCCGG
CAGCCCTCACAAACCACCCTGGCGGCTGTCTTTCCTTTGACGAAACAGTTGGACAGGGAGGACCGATGCCAGATG
ACGGAGCTGTTCTTGCAGAGCTCGCTGCTGCCTGGTCCGTGCCTGCAGGCGGCTCTTGTCGAAGCCGTCAACGAC
CAGTCTCCCGACAGGGACTTGCATCTCATCAAGCTGCTCCTGAAATACGATGCAGATGTCAGTTTCAGCCACGGG
ACTGGTCTATCCTCTCTCATCAAAGAGATTGATCTCGAGCTGCTCGATCCGCTGCTGCAAAAGGTCTCCCCGAAG
ACGGCCGCAGCTCATTTGCAAGACATGATCCGGGTTGAGGATCACTTGACGCGTGCTCACGTGGCGGCCATGCTA
CTGAGTGCTGGAGCCGACAAGGACGTCGACCAGGTTGTGGAGACCCTGTTGGCAGTCATGTCGGAGGACCCGGTT
GACCTACTGCTCTTGGACCTCCTTATCCAGCAGGGACACGCAGACGTTAACCTTTCAGACGGCGCCATTATCAAA
AAGGCCGTCGCCAACCCGAGTCCCGAGGTCCTCGAGCTCGTCATCAACCAGGGGGAGCCATCGACGTCGTCCATC
ACCCGGGCGTTGAGGGCACTGATGCCACTTCCATCGACAGAGGACAAGGCGCGGAAGCTCGAAACCCTCTTGAAC
AGGTCGACACGCAAGCAAGACGTCAATTCGATGCTCGTGCACGAAGTCAAGTCTGTCGCGCAGAGCAGCTTGGAA
TCGCCATCTCTGTCCAGTCTGAAACACCTGCTCGCCGCCGGCGCTGATCTCAATGCTCACAACGCCGCCGCTCTC
AGCCATGCCGTTATTGGGGCCAAGGCGGACGTGGTTAGAATTATGCTCGACTGGCGGTTCCCCCCGGCTCCGACG
GCGCTGGGCGTTGCGCTGCCGCACGCGCTCCGTATCACCGAGTCCACGAAGCGTCTGGAACTGACCAAAGCATTG
GTGCAGGCCGGTGTCCTTGCCGATGAAGCTGGCCGGGCCTTGACCTTTGCGATATCCAACTTTCCCAAGGATCTG
CCTCTCATCAGCGTCTTGGCTGCCAGCGCAGACCCCACTGACGGCGAAGCGCTCGCCTTGTCTGCGTCGAAAGAG
TCTCCCGAAATCATGGACGTTGTGCTGACCAGCTCCGCGTCTTCGACAGAGGCTCGAAGCTCCGCCTTGGGCTTG
GTCATGGCGGTTCAGAACAACGAGGTGCGGGGCAAGATGTGCCGAAGCCTCTTGGCTGCTGGTGTGTCGAACGAT
GCTGCTTCGAACGCGCTACTGTTCGCCTCTCGCCACGCGGACCTCGAACTATGCCACATGCTCGTGGCTCGCGGC
GCCGTGAAAGGGAGCCATGGCGGCCAAGCCGTGGTAGAGGCATGCCGTCGGGGATCGGCAGAAGTTCTCAGTGTT
CTCCTCGAGGCATGTCCCGACGACGACGAGGAGATGTTGAAGGCGGGGTTCCAGGCCGCAACCGAGGTTGGCGAC
TTGAACAAGCGCGCCATCATCTTCGAGCAACTCTTGGGCCAGGGTCTCAGCGGGGATCTGGTCGATGCCCAGCTA
CAGTCGGCGGCGCGGTATGGCCAAGATGGCATGGGAGTCTTGAAAGTTCTCTTAGCCTCAGGTGCCGACCCCAAC
TACAACAACGGAGACTGCGTCTTCTCTGCTGCCAGCTGTGCGTTTGTGGCTACCCTCGACCTGTTGCTTGGTCTG
GGAACTGAGGAGAATCATCAGAAGAAAGTGTCACAGCCGACCCTTCTCAGGGCGCTTGGAGCCTGTTGGAGCCTG
CAGCCTGACACGCGATATCTCATTGCTTGTAGCCTGTTTCAGGCTGGCCTGGGCGCTTGCGATGACCTGCACCAG
ACTCTCAACGATGCCGTCAATGAGGAGGACCCCGATGAGCGCCTGGTGAAGCTGCTTCTTGATCATGGCGCTTCT
CCCGCCGTCCATGATTGCAAGAGTTTGAAGGATGCCGCCCGGAGCATGGCAACCTCGACACTGGCCCTCCTCCTG
GCGACGGAGCTGCCAGAGGGGCGCGCAGAGGAGGCTTTTGAGGAGGCATTCTCTGCCGACAACTTTGACAGTTGG
TTCACACATGCTGGGCTCGGGACGGCGCGACTGCTCTTGGACAAAGCCGTCGACGCAGAGGCTCTTAGCCGAGCC
TTGATCCTCGTCATGAAGAACTCTTTTACAGAAGCGAGGGCTTTGGCTGACGCCTTTTTCGACTTGCTGATGGCT
CGCGGGCCAAAAATCGACCACAACGGCGGCGAACTCCTGCGACAGGCCGCGTCCATGGCAGACCAGCCTTGGACT
GCGCGGCTCCTCGAATGCCATCCATCAGCTGACACGTTGTCGTCTGCGTTTCAGTGCATCTTCAACACCGAAACC
AGCCAAGAGAGCGTTTTGGACCTCTTTAAGATGTTTACGGATTATTACGAGGAAGACGCCGAGATTGACCTTGTG
GCCGGACGGCAGGGCTACGAGCCTATGGTCAAGCGGGCCATCAACCAGTACCCGAGGTCGACCATGGTGCTCGAG
ACGCTCCTGGATGCGGGCTTTTACCACGACCAGACAACCAGGTGCCAGATCTATCCCGACTCGAGAGAGGACGAG
GAGGCAACGCTCCTGCTCTGGGCCATCGCCCAGCCGCAGAAACGAGTCAGCACGGCGGTGATTAAGACGCTGATT
GAGCGGGGAGCCAAGGTGAATGGTGAATCAAGTGTATCTCGAACAACGCCACTGATGTTGGCTACGCAAACGAGA
CGGCTGGACCTGGTCAAGTCTCTGGTCGACCACGGGGCTGACGGAGATGCCATTGACAGCCAGGGAAGGACATCG
CTCTGCATGGCAGCCACCGCCGGTGGAGATGTGGCCGTGCAACTCATGACGATCCTCCTGGTCGCCGAGCCATCC
AAGGACGACGGCTCCCTACACAATGCGGCTCGGAATCTCAACCTGCCGGCAGTCAGGCTTCTCGTGCAGGCGGGC
CACGACCCGGACTTCCCGAGTCCGCTCCACGGTGGCCGGAGTGCCCTTGGTGAGGTCTGTCTCCACGGTTCGGAT
GGAGGAGAGATGACGGCGTTGAGGGAGCGAGCCATGTTGAAGGTCATGGGCCTCCTCATGTCCGGCAACTCGGAC
CTGACGATCAAGTCCAACGACATGCCCTTTCTGCTGCTGTGTTTCGAGGCGGCCGATCCGGTGGTGACGACCAGG
GCCCTCCTCAAGAGCGGCATGTGGAAGCACGTCAACAAGCCCTTCAACCGCTTCACCTTTGGCGACTACACCTAT
TCGCCGACCATGTACATCACCAAGGTGATGGGCCCTTCGAGCGTCAACGACCAGCTCCTAGAGGTGCTACGAGCC
AGCCGTGCCATGGACATGTTTTACGCCAGCGAGGGACCGCAGCCCGACGGCGCAGTCGGTCTGCCCGAGGAGGTG
GAGGCCGAGGACCGGGCGCGCAAGGCGAGGCTCTCCCGCATCGCCATGGAGTCGGAGGACTTTTCCATCGCCATG
GCCTGCAAGCGGCAACTCGCAGACGTGGAGCAGCAGATTGCCGCTCAGCAGGACGAGGCGGAAGAGCGTCGGCGG
AGAAAGCTCCACGGCCATGACCTGGCCGTCATCCGATCCCGTCACAAGGCGACCGAAGCCGCGGCGGTAGCGTCG
CACGAGAGACGCATCGCCGAGCATCAGGCGCTGGCAAAGGCCTCCCTCGGCAGCGCCCGGGCGATGGCCGAAACG
GAACTGGAGGCGGAAGAAGCGCGCCAACGGAAAGCGCTCGCCTGGGAGCGGCAGTTCAACTCGGCTCGCGTCGGA
CACGTCCGCGCCCTCAGCACCATCAACCTAGGCGAGATGCAAGCCGTCCAACGGATCGAGAAGGATGCCCACCAG
CGGTTGGAGAAGAGACTGCTGGCGCAGAGACTGCTGGTCGAGAGTCAGGATAAGCTGGCGGGGAGACTGGGAGGG
GCGCGAACGGCCATGATTGAGGATAGGAAAAGGCCGGCTGTGGGCTATGTGACGGAGCTGGAT
Transcript >Ophio5|955
ATGACAACCGCGACGACAGCTGATCGCCAGCGGCGCCTCGTTCAGCTCTGTGAGCATTGGGGCATCGCGCCTCTC
CAGGCGTTCCCTCCTCTTCCGCCTGCGACGCCGCCGCCGTCCTTTCGCACGCCGGCAGATGATCAACTGGCCGAT
GATTTTTTGCAGCGCCGCGCCGCTGATACCGCCCATCTTCGACCCAAGGGCGTTATTCGACAGGCTTTTTCCTCG
GCTGGCCTCCGAAAGGGAAAAACCTGGGATCCAAGCCATGTGCTTGACGCCTTGACCACTTGGGTGGCTAATGCT
GGCTCACCGGGCGTCGCTGAGGTTCTCGCCGCTAAGCTGGTTGCTGCGGGCGTCCATCTGGTCGACACGCAAAGG
CAAAAGGGTAGCGGCATCCTCAACAAACGTCACAGCCTCGAGCCTCATGATGTCCGCGTCCGGCTGCTTCGTCTC
GCTGTCGTCGCAAAGAACATACAGCTGGCGCAGGTCCTACTCCCTTATGCCGAACCCGCCGTTCTCGATGCCTGC
TTGCCGTACGCCATCCGCGGCGGAGACACGGCCATGACGGAGCTCCTCCTCGTCCAAGGCGCTAGTGCGGCCTAC
AGTCGCGAGGGCCAGGATGCCTTCCGTCAGGCCTGCACCATTCACGGCCACTCGCAGTTGGTCAGCCTTGTCCTT
CGCTCTGTTCGTCACCCCGAGCCGATGTGGACGTCGACAGCCATGTGTGACGCTGCTCGAGCCGGCTGCTTCGAT
GCCGTGTTGCTCCTCAGCCACTCCACGGCCGACGGAAACCATAACCAGGCCGAGGCGCTGCGGTCTGCCGTGTGC
TCGGGAAGACAAGACATCGCCCTGGCCATCGTCATCGGAAACAACCCGCCGCAGAGGCCCGCCCTCAACAATGCT
CTCAACACAATCCAGCGTGATTCTTCTCTCGAGCCGGTCATCAAGCTCAAGCTCGTCGAAATTCTGCTCTGCGCT
GGAGCGGGCGGCGTCATGGTCTCGCAGATACTCGAGACCTACTACCAGGCTGAGTTTCTCGAAATGGCCACCTTG
CTGGCCGAGTACGGTGCGGCGGCCGAGTACGATGATGGAGCCGTACTCAAGTCGGCCATCACTCGCGGACAGCTG
GCTCTCGTAACGTCCTTTCTCCGCCTGCCGTGCGCCATCAGCCCTACCTTGGCGTCGGCTTGCATGTCTCTCATA
CCCAAAGAGGCTTCGTTCGAGCTGCGTCATGCGATTCTCAGCCTCCTCCTGCGGCAAGGCGCCACTGGAGCAGCT
CTCGACCAGATGCTCATCGACGCAGCAAAGACAGGCGACGTCAAGTCGGTCGATCTGCTGCTCACCCCTTTCTTT
CCCGCAGTCTCGCCACGCAGCTCGACGGCTCGACGGTCGTCTAGTCCCAAAAAGCACGCGGTAGCGGAAGTCGAC
TACAACTCTGGCGAGGCTCTCCGCGCTGCCCTGCTCCGCGCAGACTTGCAGATGACGCGCAAGATCCTCTCCCGG
CAGCCCTCACAAACCACCCTGGCGGCTGTCTTTCCTTTGACGAAACAGTTGGACAGGGAGGACCGATGCCAGATG
ACGGAGCTGTTCTTGCAGAGCTCGCTGCTGCCTGGTCCGTGCCTGCAGGCGGCTCTTGTCGAAGCCGTCAACGAC
CAGTCTCCCGACAGGGACTTGCATCTCATCAAGCTGCTCCTGAAATACGATGCAGATGTCAGTTTCAGCCACGGG
ACTGGTCTATCCTCTCTCATCAAAGAGATTGATCTCGAGCTGCTCGATCCGCTGCTGCAAAAGGTCTCCCCGAAG
ACGGCCGCAGCTCATTTGCAAGACATGATCCGGGTTGAGGATCACTTGACGCGTGCTCACGTGGCGGCCATGCTA
CTGAGTGCTGGAGCCGACAAGGACGTCGACCAGGTTGTGGAGACCCTGTTGGCAGTCATGTCGGAGGACCCGGTT
GACCTACTGCTCTTGGACCTCCTTATCCAGCAGGGACACGCAGACGTTAACCTTTCAGACGGCGCCATTATCAAA
AAGGCCGTCGCCAACCCGAGTCCCGAGGTCCTCGAGCTCGTCATCAACCAGGGGGAGCCATCGACGTCGTCCATC
ACCCGGGCGTTGAGGGCACTGATGCCACTTCCATCGACAGAGGACAAGGCGCGGAAGCTCGAAACCCTCTTGAAC
AGGTCGACACGCAAGCAAGACGTCAATTCGATGCTCGTGCACGAAGTCAAGTCTGTCGCGCAGAGCAGCTTGGAA
TCGCCATCTCTGTCCAGTCTGAAACACCTGCTCGCCGCCGGCGCTGATCTCAATGCTCACAACGCCGCCGCTCTC
AGCCATGCCGTTATTGGGGCCAAGGCGGACGTGGTTAGAATTATGCTCGACTGGCGGTTCCCCCCGGCTCCGACG
GCGCTGGGCGTTGCGCTGCCGCACGCGCTCCGTATCACCGAGTCCACGAAGCGTCTGGAACTGACCAAAGCATTG
GTGCAGGCCGGTGTCCTTGCCGATGAAGCTGGCCGGGCCTTGACCTTTGCGATATCCAACTTTCCCAAGGATCTG
CCTCTCATCAGCGTCTTGGCTGCCAGCGCAGACCCCACTGACGGCGAAGCGCTCGCCTTGTCTGCGTCGAAAGAG
TCTCCCGAAATCATGGACGTTGTGCTGACCAGCTCCGCGTCTTCGACAGAGGCTCGAAGCTCCGCCTTGGGCTTG
GTCATGGCGGTTCAGAACAACGAGGTGCGGGGCAAGATGTGCCGAAGCCTCTTGGCTGCTGGTGTGTCGAACGAT
GCTGCTTCGAACGCGCTACTGTTCGCCTCTCGCCACGCGGACCTCGAACTATGCCACATGCTCGTGGCTCGCGGC
GCCGTGAAAGGGAGCCATGGCGGCCAAGCCGTGGTAGAGGCATGCCGTCGGGGATCGGCAGAAGTTCTCAGTGTT
CTCCTCGAGGCATGTCCCGACGACGACGAGGAGATGTTGAAGGCGGGGTTCCAGGCCGCAACCGAGGTTGGCGAC
TTGAACAAGCGCGCCATCATCTTCGAGCAACTCTTGGGCCAGGGTCTCAGCGGGGATCTGGTCGATGCCCAGCTA
CAGTCGGCGGCGCGGTATGGCCAAGATGGCATGGGAGTCTTGAAAGTTCTCTTAGCCTCAGGTGCCGACCCCAAC
TACAACAACGGAGACTGCGTCTTCTCTGCTGCCAGCTGTGCGTTTGTGGCTACCCTCGACCTGTTGCTTGGTCTG
GGAACTGAGGAGAATCATCAGAAGAAAGTGTCACAGCCGACCCTTCTCAGGGCGCTTGGAGCCTGTTGGAGCCTG
CAGCCTGACACGCGATATCTCATTGCTTGTAGCCTGTTTCAGGCTGGCCTGGGCGCTTGCGATGACCTGCACCAG
ACTCTCAACGATGCCGTCAATGAGGAGGACCCCGATGAGCGCCTGGTGAAGCTGCTTCTTGATCATGGCGCTTCT
CCCGCCGTCCATGATTGCAAGAGTTTGAAGGATGCCGCCCGGAGCATGGCAACCTCGACACTGGCCCTCCTCCTG
GCGACGGAGCTGCCAGAGGGGCGCGCAGAGGAGGCTTTTGAGGAGGCATTCTCTGCCGACAACTTTGACAGTTGG
TTCACACATGCTGGGCTCGGGACGGCGCGACTGCTCTTGGACAAAGCCGTCGACGCAGAGGCTCTTAGCCGAGCC
TTGATCCTCGTCATGAAGAACTCTTTTACAGAAGCGAGGGCTTTGGCTGACGCCTTTTTCGACTTGCTGATGGCT
CGCGGGCCAAAAATCGACCACAACGGCGGCGAACTCCTGCGACAGGCCGCGTCCATGGCAGACCAGCCTTGGACT
GCGCGGCTCCTCGAATGCCATCCATCAGCTGACACGTTGTCGTCTGCGTTTCAGTGCATCTTCAACACCGAAACC
AGCCAAGAGAGCGTTTTGGACCTCTTTAAGATGTTTACGGATTATTACGAGGAAGACGCCGAGATTGACCTTGTG
GCCGGACGGCAGGGCTACGAGCCTATGGTCAAGCGGGCCATCAACCAGTACCCGAGGTCGACCATGGTGCTCGAG
ACGCTCCTGGATGCGGGCTTTTACCACGACCAGACAACCAGGTGCCAGATCTATCCCGACTCGAGAGAGGACGAG
GAGGCAACGCTCCTGCTCTGGGCCATCGCCCAGCCGCAGAAACGAGTCAGCACGGCGGTGATTAAGACGCTGATT
GAGCGGGGAGCCAAGGTGAATGGTGAATCAAGTGTATCTCGAACAACGCCACTGATGTTGGCTACGCAAACGAGA
CGGCTGGACCTGGTCAAGTCTCTGGTCGACCACGGGGCTGACGGAGATGCCATTGACAGCCAGGGAAGGACATCG
CTCTGCATGGCAGCCACCGCCGGTGGAGATGTGGCCGTGCAACTCATGACGATCCTCCTGGTCGCCGAGCCATCC
AAGGACGACGGCTCCCTACACAATGCGGCTCGGAATCTCAACCTGCCGGCAGTCAGGCTTCTCGTGCAGGCGGGC
CACGACCCGGACTTCCCGAGTCCGCTCCACGGTGGCCGGAGTGCCCTTGGTGAGGTCTGTCTCCACGGTTCGGAT
GGAGGAGAGATGACGGCGTTGAGGGAGCGAGCCATGTTGAAGGTCATGGGCCTCCTCATGTCCGGCAACTCGGAC
CTGACGATCAAGTCCAACGACATGCCCTTTCTGCTGCTGTGTTTCGAGGCGGCCGATCCGGTGGTGACGACCAGG
GCCCTCCTCAAGAGCGGCATGTGGAAGCACGTCAACAAGCCCTTCAACCGCTTCACCTTTGGCGACTACACCTAT
TCGCCGACCATGTACATCACCAAGGTGATGGGCCCTTCGAGCGTCAACGACCAGCTCCTAGAGGTGCTACGAGCC
AGCCGTGCCATGGACATGTTTTACGCCAGCGAGGGACCGCAGCCCGACGGCGCAGTCGGTCTGCCCGAGGAGGTG
GAGGCCGAGGACCGGGCGCGCAAGGCGAGGCTCTCCCGCATCGCCATGGAGTCGGAGGACTTTTCCATCGCCATG
GCCTGCAAGCGGCAACTCGCAGACGTGGAGCAGCAGATTGCCGCTCAGCAGGACGAGGCGGAAGAGCGTCGGCGG
AGAAAGCTCCACGGCCATGACCTGGCCGTCATCCGATCCCGTCACAAGGCGACCGAAGCCGCGGCGGTAGCGTCG
CACGAGAGACGCATCGCCGAGCATCAGGCGCTGGCAAAGGCCTCCCTCGGCAGCGCCCGGGCGATGGCCGAAACG
GAACTGGAGGCGGAAGAAGCGCGCCAACGGAAAGCGCTCGCCTGGGAGCGGCAGTTCAACTCGGCTCGCGTCGGA
CACGTCCGCGCCCTCAGCACCATCAACCTAGGCGAGATGCAAGCCGTCCAACGGATCGAGAAGGATGCCCACCAG
CGGTTGGAGAAGAGACTGCTGGCGCAGAGACTGCTGGTCGAGAGTCAGGATAAGCTGGCGGGGAGACTGGGAGGG
GCGCGAACGGCCATGATTGAGGATAGGAAAAGGCCGGCTGTGGGCTATGTGACGGAGCTGGATTAG
Gene >Ophio5|955
ATGACAACCGCGACGACAGCTGATCGCCAGCGGCGCCTCGTTCAGCTCTGTGAGCATTGGGGCATCGCGCCTCTC
CAGGCGTTCCCTCCTCTTCCGCCTGCGACGCCGCCGCCGTCCTTTCGCACGCCGGCAGATGATCAACTGGCCGAT
GATTTTTTGCAGCGCCGCGCCGCTGATACCGCCCATCTTCGACCCAAGGGCGTTATTCGACAGGCTTTTTCCTCG
GCTGGCCTCCGAAAGGGAAAAACCTGGGATCCAAGCCATGTGCTTGACGCCTTGACCACTTGGGTGGCTAATGCT
GGCTCACCGGGCGTCGCTGAGGTTCTCGCCGCTAAGCTGGTTGCTGCGGGCGTCCATCTGGTCGACACGCAAAGG
CAAAAGGGTAGCGGCATCCTCAACAAACGTCACAGCCTCGAGCCTCATGATGTCCGCGTCCGGCTGCTTCGTCTC
GCTGTCGTCGCAAAGAACATACAGCTGGCGCAGGTCCTACTCCCTTATGCCGAACCCGCCGTTCTCGATGCCTGC
TTGCCGTACGCCATCCGCGGCGGAGACACGGCCATGACGGAGCTCCTCCTCGTCCAAGGCGCTAGTGCGGCCTAC
AGTCGCGAGGGCCAGGATGCCTTCCGTCAGGCCTGCACCATTCACGGCCACTCGCAGTTGGTCAGCCTTGTCCTT
CGCTCTGTTCGTCACCCCGAGCCGATGTGGACGTCGACAGCCATGTGTGACGCTGCTCGAGCCGGCTGCTTCGAT
GCCGTGTTGCTCCTCAGCCACTCCACGGCCGACGGAAACCATAACCAGGCCGAGGCGCTGCGGTCTGCCGTGTGC
TCGGGAAGACAAGACATCGCCCTGGCCATCGTCATCGGAAACAACCCGCCGCAGAGGCCCGCCCTCAACAATGCT
CTCAACACAATCCAGCGTGATTCTTCTCTCGAGCCGGTCATCAAGCTCAAGCTCGTCGAAATTCTGCTCTGCGCT
GGAGCGGGCGGCGTCATGGTCTCGCAGATACTCGAGACCTACTACCAGGCTGAGTTTCTCGAAATGGCCACCTTG
CTGGCCGAGTACGGTGCGGCGGCCGAGTACGATGATGGAGCCGTACTCAAGTCGGCCATCACTCGCGGACAGCTG
GCTCTCGTAACGTCCTTTCTCCGCCTGCCGTGCGCCATCAGCCCTACCTTGGCGTCGGCTTGCATGTCTCTCATA
CCCAAAGAGGCTTCGTTCGAGCTGCGTCATGCGATTCTCAGCCTCCTCCTGCGGCAAGGCGCCACTGGAGCAGCT
CTCGACCAGATGCTCATCGACGCAGCAAAGACAGGCGACGTCAAGTCGGTCGATCTGCTGCTCACCCCTTTCTTT
CCCGCAGTCTCGCCACGCAGCTCGACGGCTCGACGGTCGTCTAGTCCCAAAAAGCACGCGGTAGCGGAAGTCGAC
TACAACTCTGGCGAGGCTCTCCGCGCTGCCCTGCTCCGCGCAGACTTGCAGATGACGCGCAAGATCCTCTCCCGG
CAGCCCTCACAAACCACCCTGGCGGCTGTCTTTCCTTTGACGAAACAGTTGGACAGGGAGGACCGATGCCAGATG
ACGGAGCTGTTCTTGCAGAGCTCGCTGCTGCCTGGTCCGTGCCTGCAGGCGGCTCTTGTCGAAGCCGTCAACGAC
CAGTCTCCCGACAGGGACTTGCATCTCATCAAGCTGCTCCTGAAATACGATGCAGATGTCAGTTTCAGCCACGGG
ACTGGTCTATCCTCTCTCATCAAAGAGATTGATCTCGAGCTGCTCGATCCGCTGCTGCAAAAGGTCTCCCCGAAG
ACGGCCGCAGCTCATTTGCAAGACATGATCCGGGTTGAGGATCACTTGACGCGTGCTCACGTGGCGGCCATGCTA
CTGAGTGCTGGAGCCGACAAGGACGTCGACCAGGTTGTGGAGACCCTGTTGGCAGTCATGTCGGAGGACCCGGTT
GACCTACTGCTCTTGGACCTCCTTATCCAGCAGGGACACGCAGACGTTAACCTTTCAGACGGCGCCATTATCAAA
AAGGCCGTCGCCAACCCGAGTCCCGAGGTCCTCGAGCTCGTCATCAACCAGGGGGAGCCATCGACGTCGTCCATC
ACCCGGGCGTTGAGGGCACTGATGCCACTTCCATCGACAGAGGACAAGGCGCGGAAGCTCGAAACCCTCTTGAAC
AGGTCGACACGCAAGCAAGACGTCAATTCGATGCTCGTGCACGAAGTCAAGTCTGTCGCGCAGAGCAGCTTGGAA
TCGCCATCTCTGTCCAGTCTGAAACACCTGCTCGCCGCCGGCGCTGATCTCAATGCTCACAACGCCGCCGCTCTC
AGCCATGCCGTTATTGGGGCCAAGGCGGACGTGGTTAGAATTATGCTCGACTGGCGGTTCCCCCCGGCTCCGACG
GCGCTGGGCGTTGCGCTGCCGCACGCGCTCCGTATCACCGAGTCCACGAAGCGTCTGGAACTGACCAAAGCATTG
GTGCAGGCCGGTGTCCTTGCCGATGAAGCTGGCCGGGCCTTGACCTTTGCGATATCCAACTTTCCCAAGGATCTG
CCTCTCATCAGCGTCTTGGCTGCCAGCGCAGACCCCACTGACGGCGAAGCGCTCGCCTTGTCTGCGTCGAAAGAG
TCTCCCGAAATCATGGACGTTGTGCTGACCAGCTCCGCGTCTTCGACAGAGGCTCGAAGCTCCGCCTTGGGCTTG
GTCATGGCGGTTCAGAACAACGAGGTGCGGGGCAAGATGTGCCGAAGCCTCTTGGCTGCTGGTGTGTCGAACGAT
GCTGCTTCGAACGCGCTACTGTTCGCCTCTCGCCACGCGGACCTCGAACTATGCCACATGCTCGTGGCTCGCGGC
GCCGTGAAAGGGAGCCATGGCGGCCAAGCCGTGGTAGAGGCATGCCGTCGGGGATCGGCAGAAGTTCTCAGTGTT
CTCCTCGAGGCATGTCCCGACGACGACGAGGAGATGTTGAAGGCGGGGTTCCAGGCCGCAACCGAGGTTGGCGAC
TTGAACAAGCGCGCCATCATCTTCGAGCAACTCTTGGGCCAGGGTCTCAGCGGGGATCTGGTCGATGCCCAGCTA
CAGTCGGCGGCGCGGTATGGCCAAGATGGCATGGGAGTCTTGAAAGTTCTCTTAGCCTCAGGTGCCGACCCCAAC
TACAACAACGGAGACTGCGTCTTCTCTGCTGCCAGCTGTGCGTTTGTGGCTACCCTCGACCTGTTGCTTGGTCTG
GGAACTGAGGAGAATCATCAGGTAAGTGACATACCCCACCATGGCGATGAAGCTGCCCCTGACGCCTCGCCTCCA
GAAGAAAGTGTCACAGCCGACCCTTCTCAGGGCGCTTGGAGCCTGTTGGAGCCTGCAGCCTGACACGCGATATCT
CATTGCTTGTAGCCTGTTTCAGGCTGGCCTGGGCGCTTGCGATGACCTGCACCAGACTCTCAACGATGCCGTCAA
TGAGGAGGACCCCGATGAGCGCCTGGTGAAGCTGCTTCTTGATCATGGCGCTTCTCCCGCCGTCCATGATTGCAA
GAGTTTGAAGGATGCCGCCCGGAGCATGGCAACCTCGACACTGGCCCTCCTCCTGGCGACGGAGCTGCCAGAGGG
GCGCGCAGAGGAGGCTTTTGAGGAGGCATTCTCTGCCGACAACTTTGACAGTTGGTTCACACATGCTGGGCTCGG
GACGGCGCGACTGCTCTTGGACAAAGCCGTCGACGCAGAGGCTCTTAGCCGAGCCTTGATCCTCGTCATGAAGAA
CTCTTTTACAGAAGCGAGGGCTTTGGCTGACGCCTTTTTCGACTTGCTGATGGCTCGCGGGCCAAAAATCGACCA
CAACGGCGGCGAACTCCTGCGACAGGCCGCGTCCATGGCAGACCAGCCTTGGACTGCGCGGCTCCTCGAATGCCA
TCCATCAGCTGACACGTTGTCGTCTGCGTTTCAGTGCATCTTCAACACCGAAACCAGCCAAGAGAGCGTTTTGGA
CCTCTTTAAGATGTTTACGGATTATTACGAGGAAGACGCCGAGATTGACCTTGTGGCCGGACGGCAGGGCTACGA
GCCTATGGTCAAGCGGGCCATCAACCAGTACCCGAGGTCGACCATGGTGCTCGAGACGCTCCTGGATGCGGGCTT
TTACCACGACCAGACAACCAGGTGCCAGATCTATCCCGACTCGAGAGAGGACGAGGAGGCAACGCTCCTGCTCTG
GGCCATCGCCCAGCCGCAGAAACGAGTCAGCACGGCGGTGATTAAGACGCTGATTGAGCGGGGAGGTGAGCAACA
GCTCTGATACGAAACCACTCCTGCGAGCATGCTTGCTAACGTCATCTCCTATAGCCAAGGTGAATGGTGAATCAA
GTGTATCTCGAACAACGCCACTGATGTTGGCTACGCAAACGAGACGGCTGGACCTGGTCAAGTCTCTGGTCGACC
ACGGGGCTGACGGAGATGCCATTGACAGCCAGGGAAGGACATCGCTCTGCATGGCAGCCACCGCCGGTGGAGATG
TGGCCGTGCAACTCATGACGATCCTCCTGGTCGCCGAGCCATCCAAGGACGACGGCTCCCTACACAATGCGGCTC
GGAATCTCAACCTGCCGGCAGTCAGGCTTCTCGTGCAGGCGGGCCACGACCCGGACTTCCCGAGTCCGCTCCACG
GTGGCCGGAGTGCCCTTGGTGAGGTCTGTCTCCACGGTTCGGATGGAGGAGAGATGACGGCGTTGAGGGAGCGAG
CCATGTTGAAGGTCATGGGCCTCCTCATGTCCGGCAACTCGGACCTGACGATCAAGTCCAACGACATGCCCTTTC
TGCTGCTGTGTTTCGAGGCGGCCGATCCGGTGGTGACGACCAGGGCCCTCCTCAAGAGCGGCATGTGGAAGCACG
TCAACAAGCCCTTCAACCGCTTCACCTTTGGCGACTACACCTATTCGCCGACCATGTACATCACCAAGGTGATGG
GCCCTTCGAGCGTCAACGACCAGCTCCTAGAGGTGCTACGAGCCAGCCGTGCCATGGACATGTTTTACGCCAGCG
AGGGACCGCAGCCCGACGGCGCAGTCGGTCTGCCCGAGGAGGTGGAGGCCGAGGACCGGGCGCGCAAGGCGAGGC
TCTCCCGCATCGCCATGGAGTCGGAGGACTTTTCCATCGCCATGGCCTGCAAGCGGCAACTCGCAGACGTGGAGC
AGCAGATTGCCGCTCAGCAGGACGAGGCGGAAGAGCGTCGGCGGAGAAAGCTCCACGGCCATGACCTGGCCGTCA
TCCGATCCCGTCACAAGGCGACCGAAGCCGCGGCGGTAGCGTCGCACGAGAGACGCATCGCCGAGCATCAGGCGC
TGGCAAAGGCCTCCCTCGGCAGCGCCCGGGCGATGGCCGAAACGGAACTGGAGGCGGAAGAAGCGCGCCAACGGA
AAGCGCTCGCCTGGGAGCGGCAGTTCAACTCGGCTCGCGTCGGACACGTCCGCGCCCTCAGCACCATCAACCTAG
GCGAGATGCAAGCCGTCCAACGGATCGAGAAGGATGCCCACCAGCGGTTGGAGAAGAGACTGCTGGCGCAGAGAC
TGCTGGTCGAGAGTCAGGATAAGCTGGCGGGGAGACTGGGAGGGGCGCGAACGGCCATGATTGAGGATAGGAAAA
GGCCGGCTGTGGGCTATGTGACGGAGCTGGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail