Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|948
Gene name
Locationscaffold_129:5128..6616
Strand+
Gene length (bp)1488
Transcript length (bp)1488
Coding sequence length (bp)1485
Protein length (aa) 495

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11710 Git3 G protein-coupled glucose receptor regulating Gpa2 1.4E-36 35 245
PF11970 GPR_Gpa2_C G protein-coupled glucose receptor regulating Gpa2 C-term 1.5E-17 335 405

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12361|GPR1_YEAST G protein-coupled receptor GPR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPR1 PE=1 SV=1 32 248 1.0E-13
sp|Q12361|GPR1_YEAST G protein-coupled receptor GPR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPR1 PE=1 SV=1 333 407 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 37 59 22
2 90 112 22
3 132 154 22
4 175 197 22
5 217 239 22
6 346 368 22
7 378 400 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 15.70 6.84 24.57
CcL In ants, during behavior modification 3.58 0.65 6.51
CcD In ants, recently dead 9.72 3.64 15.80

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.114715 no
CcL CcD 0.009968 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|948
MTDSGYSLDQISFSWPSTSLAHESGQDGSPGQLLALRTTSLVLASFSVLSTALTSICFLRVRKNFRHEYASSPPP
PSFLHPCPLVLADGFCYSLIVILLQIDLFKSALLLVVPAVELSRHGHVDSGSMVCDVAGFLLLFALEACNVAIVL
LALHTAFNVFFHGQGGLYPHRRLAWLVGVVLPLALALLAFINQPAFVNSGDYCRVPAMPRWPRLVLIWLPRCLCL
VIIAFTYVATFIYVQQLMRRFGAGPVQPWPQTLVPESQSPPSLASLRLMPRQTDMLPPRDPGIRPVLTLASVSGP
HPLPPSDSDTLQPRLDSSTAILLSPATLGATGMAKTRGKIRRQLRLLIIYPMVYTGLWTVPFICHILSFLDHGES
FGLTLASIASLSLQGTADALVFLVLEKPWRQARNAGAASWLARPIEGAATNAGRNRNEMRFDSRMARHRREDELA
AERRLRPMIKQSAGRVREWWDVRLETDDDDDDDQEGLGASQRSWA
Coding >Ophio5|948
ATGACCGACTCTGGCTATAGCCTCGACCAGATCAGCTTCTCGTGGCCGTCGACGTCTCTCGCGCATGAGAGCGGT
CAAGACGGATCTCCTGGCCAGCTTCTGGCGCTGAGAACGACGAGTCTTGTCCTCGCTAGCTTCAGCGTCTTGTCG
ACAGCGCTGACATCTATTTGCTTCCTTCGCGTGAGGAAAAACTTTCGGCATGAGTACGCGTCTTCCCCCCCCCCC
CCTTCTTTCCTTCACCCATGTCCTCTGGTTCTCGCTGACGGTTTCTGTTACAGCCTCATCGTGATCCTCCTCCAA
ATCGACCTCTTCAAATCAGCTCTCCTCCTTGTCGTGCCCGCCGTCGAACTCTCCCGCCATGGCCATGTCGATTCC
GGCTCCATGGTATGCGACGTCGCCGGCTTCCTTCTTCTCTTCGCGCTCGAAGCTTGTAATGTCGCCATCGTCTTG
CTGGCCTTGCATACGGCTTTCAACGTTTTTTTTCACGGCCAAGGTGGCCTTTATCCTCATCGGCGTCTTGCCTGG
CTTGTTGGTGTCGTGCTGCCGCTGGCTCTCGCTTTACTTGCCTTTATCAATCAGCCTGCCTTTGTCAACTCGGGG
GATTACTGTCGTGTGCCCGCCATGCCCCGATGGCCTCGTCTGGTGTTGATATGGCTTCCTCGCTGCCTGTGTCTC
GTCATCATCGCCTTCACGTACGTCGCCACCTTCATCTACGTCCAGCAGCTCATGAGGCGCTTCGGCGCTGGGCCC
GTCCAGCCTTGGCCTCAGACTCTCGTGCCGGAGTCTCAGTCTCCGCCTTCGTTGGCTTCGCTGCGTCTCATGCCG
CGGCAGACGGACATGTTGCCGCCCCGGGACCCGGGCATCCGTCCGGTGTTGACGCTGGCTTCCGTCTCGGGCCCT
CATCCGCTACCACCATCCGATTCCGACACTCTACAGCCGCGCTTAGACTCTTCGACGGCCATTCTGCTCTCTCCA
GCGACGCTCGGCGCCACGGGCATGGCCAAGACGCGTGGCAAGATTCGTCGCCAGCTGCGCCTGCTCATCATCTAC
CCGATGGTCTACACGGGCCTGTGGACCGTCCCTTTCATCTGCCACATCCTGAGCTTTCTTGACCACGGCGAATCC
TTTGGCCTCACCTTGGCCAGCATCGCCAGCCTGAGCCTACAGGGCACCGCCGACGCCCTCGTTTTTCTAGTCCTC
GAGAAGCCGTGGCGACAAGCGCGAAATGCCGGAGCGGCGTCCTGGCTTGCTCGCCCCATCGAGGGCGCGGCCACC
AACGCCGGACGGAACCGTAATGAGATGCGCTTCGATAGCCGCATGGCGAGACACCGCCGCGAGGATGAACTCGCT
GCCGAACGGAGACTGCGGCCCATGATCAAGCAGAGCGCGGGCCGGGTTCGGGAGTGGTGGGACGTGCGTCTGGAG
ACTGACGACGACGATGACGACGACCAAGAGGGTCTCGGTGCCAGCCAACGTTCATGGGCA
Transcript >Ophio5|948
ATGACCGACTCTGGCTATAGCCTCGACCAGATCAGCTTCTCGTGGCCGTCGACGTCTCTCGCGCATGAGAGCGGT
CAAGACGGATCTCCTGGCCAGCTTCTGGCGCTGAGAACGACGAGTCTTGTCCTCGCTAGCTTCAGCGTCTTGTCG
ACAGCGCTGACATCTATTTGCTTCCTTCGCGTGAGGAAAAACTTTCGGCATGAGTACGCGTCTTCCCCCCCCCCC
CCTTCTTTCCTTCACCCATGTCCTCTGGTTCTCGCTGACGGTTTCTGTTACAGCCTCATCGTGATCCTCCTCCAA
ATCGACCTCTTCAAATCAGCTCTCCTCCTTGTCGTGCCCGCCGTCGAACTCTCCCGCCATGGCCATGTCGATTCC
GGCTCCATGGTATGCGACGTCGCCGGCTTCCTTCTTCTCTTCGCGCTCGAAGCTTGTAATGTCGCCATCGTCTTG
CTGGCCTTGCATACGGCTTTCAACGTTTTTTTTCACGGCCAAGGTGGCCTTTATCCTCATCGGCGTCTTGCCTGG
CTTGTTGGTGTCGTGCTGCCGCTGGCTCTCGCTTTACTTGCCTTTATCAATCAGCCTGCCTTTGTCAACTCGGGG
GATTACTGTCGTGTGCCCGCCATGCCCCGATGGCCTCGTCTGGTGTTGATATGGCTTCCTCGCTGCCTGTGTCTC
GTCATCATCGCCTTCACGTACGTCGCCACCTTCATCTACGTCCAGCAGCTCATGAGGCGCTTCGGCGCTGGGCCC
GTCCAGCCTTGGCCTCAGACTCTCGTGCCGGAGTCTCAGTCTCCGCCTTCGTTGGCTTCGCTGCGTCTCATGCCG
CGGCAGACGGACATGTTGCCGCCCCGGGACCCGGGCATCCGTCCGGTGTTGACGCTGGCTTCCGTCTCGGGCCCT
CATCCGCTACCACCATCCGATTCCGACACTCTACAGCCGCGCTTAGACTCTTCGACGGCCATTCTGCTCTCTCCA
GCGACGCTCGGCGCCACGGGCATGGCCAAGACGCGTGGCAAGATTCGTCGCCAGCTGCGCCTGCTCATCATCTAC
CCGATGGTCTACACGGGCCTGTGGACCGTCCCTTTCATCTGCCACATCCTGAGCTTTCTTGACCACGGCGAATCC
TTTGGCCTCACCTTGGCCAGCATCGCCAGCCTGAGCCTACAGGGCACCGCCGACGCCCTCGTTTTTCTAGTCCTC
GAGAAGCCGTGGCGACAAGCGCGAAATGCCGGAGCGGCGTCCTGGCTTGCTCGCCCCATCGAGGGCGCGGCCACC
AACGCCGGACGGAACCGTAATGAGATGCGCTTCGATAGCCGCATGGCGAGACACCGCCGCGAGGATGAACTCGCT
GCCGAACGGAGACTGCGGCCCATGATCAAGCAGAGCGCGGGCCGGGTTCGGGAGTGGTGGGACGTGCGTCTGGAG
ACTGACGACGACGATGACGACGACCAAGAGGGTCTCGGTGCCAGCCAACGTTCATGGGCATGA
Gene >Ophio5|948
ATGACCGACTCTGGCTATAGCCTCGACCAGATCAGCTTCTCGTGGCCGTCGACGTCTCTCGCGCATGAGAGCGGT
CAAGACGGATCTCCTGGCCAGCTTCTGGCGCTGAGAACGACGAGTCTTGTCCTCGCTAGCTTCAGCGTCTTGTCG
ACAGCGCTGACATCTATTTGCTTCCTTCGCGTGAGGAAAAACTTTCGGCATGAGTACGCGTCTTCCCCCCCCCCC
CCTTCTTTCCTTCACCCATGTCCTCTGGTTCTCGCTGACGGTTTCTGTTACAGCCTCATCGTGATCCTCCTCCAA
ATCGACCTCTTCAAATCAGCTCTCCTCCTTGTCGTGCCCGCCGTCGAACTCTCCCGCCATGGCCATGTCGATTCC
GGCTCCATGGTATGCGACGTCGCCGGCTTCCTTCTTCTCTTCGCGCTCGAAGCTTGTAATGTCGCCATCGTCTTG
CTGGCCTTGCATACGGCTTTCAACGTTTTTTTTCACGGCCAAGGTGGCCTTTATCCTCATCGGCGTCTTGCCTGG
CTTGTTGGTGTCGTGCTGCCGCTGGCTCTCGCTTTACTTGCCTTTATCAATCAGCCTGCCTTTGTCAACTCGGGG
GATTACTGTCGTGTGCCCGCCATGCCCCGATGGCCTCGTCTGGTGTTGATATGGCTTCCTCGCTGCCTGTGTCTC
GTCATCATCGCCTTCACGTACGTCGCCACCTTCATCTACGTCCAGCAGCTCATGAGGCGCTTCGGCGCTGGGCCC
GTCCAGCCTTGGCCTCAGACTCTCGTGCCGGAGTCTCAGTCTCCGCCTTCGTTGGCTTCGCTGCGTCTCATGCCG
CGGCAGACGGACATGTTGCCGCCCCGGGACCCGGGCATCCGTCCGGTGTTGACGCTGGCTTCCGTCTCGGGCCCT
CATCCGCTACCACCATCCGATTCCGACACTCTACAGCCGCGCTTAGACTCTTCGACGGCCATTCTGCTCTCTCCA
GCGACGCTCGGCGCCACGGGCATGGCCAAGACGCGTGGCAAGATTCGTCGCCAGCTGCGCCTGCTCATCATCTAC
CCGATGGTCTACACGGGCCTGTGGACCGTCCCTTTCATCTGCCACATCCTGAGCTTTCTTGACCACGGCGAATCC
TTTGGCCTCACCTTGGCCAGCATCGCCAGCCTGAGCCTACAGGGCACCGCCGACGCCCTCGTTTTTCTAGTCCTC
GAGAAGCCGTGGCGACAAGCGCGAAATGCCGGAGCGGCGTCCTGGCTTGCTCGCCCCATCGAGGGCGCGGCCACC
AACGCCGGACGGAACCGTAATGAGATGCGCTTCGATAGCCGCATGGCGAGACACCGCCGCGAGGATGAACTCGCT
GCCGAACGGAGACTGCGGCCCATGATCAAGCAGAGCGCGGGCCGGGTTCGGGAGTGGTGGGACGTGCGTCTGGAG
ACTGACGACGACGATGACGACGACCAAGAGGGTCTCGGTGCCAGCCAACGTTCATGGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail