Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|944
Gene name
Locationscaffold_1289:296..2120
Strand-
Gene length (bp)1824
Transcript length (bp)1353
Coding sequence length (bp)1350
Protein length (aa) 450

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T) 2.8E-38 224 411
PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain 7.4E-18 1 112

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14018|SYSC_SCHPO Serine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC29A4.15 PE=3 SV=1 1 448 0.0E+00
sp|Q9HGT6|SYSC_CANAL Serine--tRNA ligase, cytoplasmic OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SES1 PE=1 SV=1 1 450 0.0E+00
sp|P07284|SYSC_YEAST Serine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SES1 PE=1 SV=2 1 441 0.0E+00
sp|Q7KWQ2|SYSC_DICDI Serine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=serS PE=1 SV=1 2 449 6.0E-174
sp|O81983|SYS_HELAN Serine--tRNA ligase OS=Helianthus annuus PE=2 SV=1 1 442 3.0E-162
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14018|SYSC_SCHPO Serine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC29A4.15 PE=3 SV=1 1 448 0.0E+00
sp|Q9HGT6|SYSC_CANAL Serine--tRNA ligase, cytoplasmic OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SES1 PE=1 SV=1 1 450 0.0E+00
sp|P07284|SYSC_YEAST Serine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SES1 PE=1 SV=2 1 441 0.0E+00
sp|Q7KWQ2|SYSC_DICDI Serine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=serS PE=1 SV=1 2 449 6.0E-174
sp|O81983|SYS_HELAN Serine--tRNA ligase OS=Helianthus annuus PE=2 SV=1 1 442 3.0E-162
sp|Q39230|SYSC_ARATH Serine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At5g27470 PE=2 SV=1 1 450 7.0E-160
sp|P26638|SYSC_MOUSE Serine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Sars PE=1 SV=3 1 449 8.0E-149
sp|Q6P799|SYSC_RAT Serine--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Sars PE=1 SV=3 1 449 4.0E-148
sp|Q9GMB8|SYSC_BOVIN Serine--tRNA ligase, cytoplasmic OS=Bos taurus GN=SARS PE=2 SV=3 1 449 2.0E-147
sp|Q4R4U9|SYSC_MACFA Serine--tRNA ligase, cytoplasmic OS=Macaca fascicularis GN=SARS PE=2 SV=3 1 449 2.0E-146
sp|P49591|SYSC_HUMAN Serine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=SARS PE=1 SV=3 1 449 1.0E-145
sp|Q5R9K9|SYSC_PONAB Serine--tRNA ligase, cytoplasmic OS=Pongo abelii GN=SARS PE=2 SV=3 1 449 1.0E-145
sp|Q18678|SYSC_CAEEL Probable serine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=srs-2 PE=3 SV=1 1 450 2.0E-140
sp|Q8SS48|SYS_ENCCU Serine--tRNA ligase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU04_0750 PE=1 SV=1 1 429 5.0E-111
sp|Q2NEU9|SYS_METST Serine--tRNA ligase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=serS PE=3 SV=1 1 429 2.0E-103
sp|A9A4V3|SYS_NITMS Serine--tRNA ligase OS=Nitrosopumilus maritimus (strain SCM1) GN=serS PE=3 SV=1 15 427 2.0E-95
sp|O28244|SYS_ARCFU Serine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=serS PE=3 SV=1 14 427 4.0E-94
sp|A0RTS8|SYS_CENSY Serine--tRNA ligase OS=Cenarchaeum symbiosum (strain A) GN=serS PE=3 SV=1 15 427 5.0E-93
sp|A3CTP4|SYS_METMJ Serine--tRNA ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=serS PE=3 SV=1 15 430 5.0E-93
sp|Q8U1K2|SYS_PYRFU Serine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=serS PE=3 SV=1 1 426 3.0E-92
sp|A7I890|SYS_METB6 Serine--tRNA ligase OS=Methanoregula boonei (strain 6A8) GN=serS PE=3 SV=1 10 427 1.0E-91
sp|Q0W8S5|SYS_METAR Serine--tRNA ligase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=serS PE=3 SV=1 1 429 8.0E-91
sp|C5A226|SYS_THEGJ Serine--tRNA ligase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=serS PE=3 SV=1 1 430 1.0E-90
sp|C5CGC3|SYS_KOSOT Serine--tRNA ligase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=serS PE=3 SV=1 14 427 2.0E-90
sp|O58441|SYS_PYRHO Serine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=serS PE=1 SV=2 14 426 3.0E-89
sp|Q5JE75|SYS_THEKO Serine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=serS PE=3 SV=1 14 426 4.0E-89
sp|Q2FS27|SYS_METHJ Serine--tRNA ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=serS PE=3 SV=1 1 427 1.0E-88
sp|Q9UZ21|SYS_PYRAB Serine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=serS PE=3 SV=1 14 426 1.0E-88
sp|A2SRC6|SYS_METLZ Serine--tRNA ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=serS PE=3 SV=1 1 429 2.0E-88
sp|Q9HKX5|SYS_THEAC Serine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=serS PE=3 SV=1 32 426 5.0E-88
sp|Q6KZN5|SYS_PICTO Serine--tRNA ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=serS PE=3 SV=1 21 426 2.0E-87
sp|B6YWW5|SYS_THEON Serine--tRNA ligase OS=Thermococcus onnurineus (strain NA1) GN=serS PE=3 SV=1 29 426 3.0E-87
sp|A2BM70|SYS_HYPBU Serine--tRNA ligase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=serS PE=3 SV=1 14 431 2.0E-86
sp|Q9ZBX1|SYS_STRCO Serine--tRNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=serS PE=3 SV=1 14 429 4.0E-86
sp|Q8CU95|SYS_STAES Serine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=serS PE=3 SV=1 1 429 5.0E-86
sp|Q5HK07|SYS_STAEQ Serine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=serS PE=3 SV=1 1 429 5.0E-86
sp|Q4A172|SYS_STAS1 Serine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=serS PE=3 SV=1 1 429 6.0E-86
sp|B1L5G0|SYS_KORCO Serine--tRNA ligase OS=Korarchaeum cryptofilum (strain OPF8) GN=serS PE=3 SV=1 14 427 3.0E-85
sp|Q6GKT6|SYS_STAAR Serine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=serS PE=3 SV=1 1 438 3.0E-85
sp|B1YGC4|SYS_EXIS2 Serine--tRNA ligase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=serS PE=3 SV=1 14 429 5.0E-85
sp|A8YYT2|SYS_STAAT Serine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=serS PE=3 SV=1 1 438 9.0E-85
sp|A6QD48|SYS_STAAE Serine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=serS PE=3 SV=1 1 438 9.0E-85
sp|Q5HJY7|SYS_STAAC Serine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=serS PE=3 SV=1 1 438 9.0E-85
sp|P95689|SYS_STAA8 Serine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=serS PE=3 SV=1 1 438 9.0E-85
sp|Q2FKP7|SYS_STAA3 Serine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=serS PE=3 SV=1 1 438 9.0E-85
sp|P99178|SYS_STAAN Serine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=serS PE=1 SV=1 1 438 2.0E-84
sp|P61083|SYS_STAAM Serine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=serS PE=3 SV=1 1 438 2.0E-84
sp|A5INQ0|SYS_STAA9 Serine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=serS PE=3 SV=1 1 438 2.0E-84
sp|A6TXF9|SYS_STAA2 Serine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=serS PE=3 SV=1 1 438 2.0E-84
sp|A7WWP0|SYS_STAA1 Serine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=serS PE=3 SV=1 1 438 2.0E-84
sp|B1VP80|SYS_STRGG Serine--tRNA ligase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=serS PE=3 SV=1 14 429 2.0E-84
sp|Q6GD81|SYS_STAAS Serine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=serS PE=3 SV=1 1 438 2.0E-84
sp|Q8NYY2|SYS_STAAW Serine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=serS PE=3 SV=1 1 438 3.0E-84
sp|C5D340|SYS_GEOSW Serine--tRNA ligase OS=Geobacillus sp. (strain WCH70) GN=serS PE=3 SV=1 16 427 1.0E-83
sp|Q2YUR2|SYS_STAAB Serine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=serS PE=3 SV=1 1 438 1.0E-83
sp|Q5L3Y0|SYS_GEOKA Serine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=serS PE=3 SV=1 1 427 1.0E-83
sp|Q82FK8|SYS1_STRAW Serine--tRNA ligase 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=serS1 PE=3 SV=1 14 429 2.0E-83
sp|Q979Z3|SYS_THEVO Serine--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=serS PE=3 SV=1 105 426 4.0E-83
sp|B0RCF1|SYS_CLAMS Serine--tRNA ligase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=serS PE=3 SV=1 14 429 4.0E-83
sp|B9DPW5|SYS_STACT Serine--tRNA ligase OS=Staphylococcus carnosus (strain TM300) GN=serS PE=3 SV=1 1 429 5.0E-83
sp|O66647|SYS_AQUAE Serine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=serS PE=1 SV=1 1 427 8.0E-83
sp|A3CQ45|SYS_STRSV Serine--tRNA ligase OS=Streptococcus sanguinis (strain SK36) GN=serS PE=3 SV=1 1 429 3.0E-82
sp|B8CZZ9|SYS_HALOH Serine--tRNA ligase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=serS PE=3 SV=1 16 427 3.0E-82
sp|C6A4A3|SYS_THESM Serine--tRNA ligase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=serS PE=3 SV=1 32 426 6.0E-82
sp|B1I9K5|SYS_STRPI Serine--tRNA ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=serS PE=3 SV=1 1 430 7.0E-82
sp|C1CPS1|SYS_STRZT Serine--tRNA ligase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=serS PE=3 SV=1 1 430 8.0E-82
sp|Q97SG0|SYS_STRPN Serine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=serS PE=3 SV=1 1 430 8.0E-82
sp|A5D6D5|SYS_PELTS Serine--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=serS PE=3 SV=1 1 429 8.0E-82
sp|C1CIR2|SYS_STRZP Serine--tRNA ligase OS=Streptococcus pneumoniae (strain P1031) GN=serS PE=3 SV=1 1 430 9.0E-82
sp|C1C5E8|SYS_STRP7 Serine--tRNA ligase OS=Streptococcus pneumoniae (strain 70585) GN=serS PE=3 SV=1 1 430 9.0E-82
sp|B8ZLH8|SYS_STRPJ Serine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=serS PE=3 SV=1 1 430 9.0E-82
sp|B9MQM8|SYS_CALBD Serine--tRNA ligase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=serS PE=3 SV=1 13 427 1.0E-81
sp|Q97N17|SYS1_CLOAB Serine--tRNA ligase 1 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=serS1 PE=3 SV=1 1 427 2.0E-81
sp|C0ZH54|SYS_BREBN Serine--tRNA ligase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=serS PE=3 SV=1 14 429 2.0E-81
sp|B9E909|SYS_MACCJ Serine--tRNA ligase OS=Macrococcus caseolyticus (strain JCSC5402) GN=serS PE=3 SV=1 1 429 2.0E-81
sp|C1CCH7|SYS_STRZJ Serine--tRNA ligase OS=Streptococcus pneumoniae (strain JJA) GN=serS PE=3 SV=1 1 430 2.0E-81
sp|Q970Y4|SYS_SULTO Serine--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=serS PE=3 SV=1 13 427 3.0E-81
sp|Q8DR22|SYS_STRR6 Serine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=serS PE=3 SV=2 1 430 3.0E-81
sp|Q04M63|SYS_STRP2 Serine--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=serS PE=3 SV=1 1 430 3.0E-81
sp|Q4J8I4|SYS_SULAC Serine--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=serS PE=3 SV=1 13 445 4.0E-81
sp|A8AYV0|SYS_STRGC Serine--tRNA ligase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=serS PE=3 SV=1 25 429 4.0E-81
sp|A8AB67|SYS_IGNH4 Serine--tRNA ligase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=serS PE=3 SV=1 14 427 6.0E-81
sp|Q4LAK8|SYS_STAHJ Serine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=serS PE=3 SV=1 25 429 1.0E-80
sp|C4KZX8|SYS_EXISA Serine--tRNA ligase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=serS PE=3 SV=1 1 429 1.0E-80
sp|A4YI40|SYS_METS5 Serine--tRNA ligase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=serS PE=3 SV=1 13 427 3.0E-80
sp|A3DI04|SYS_CLOTH Serine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=serS PE=3 SV=1 14 429 6.0E-80
sp|A5CNA2|SYS_CLAM3 Serine--tRNA ligase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=serS PE=3 SV=1 14 429 7.0E-80
sp|A0Q3T2|SYS_CLONN Serine--tRNA ligase OS=Clostridium novyi (strain NT) GN=serS PE=3 SV=1 14 427 7.0E-80
sp|B5YGU2|SYS_THEYD Serine--tRNA ligase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=serS PE=3 SV=1 1 427 7.0E-80
sp|A3DP85|SYS_STAMF Serine--tRNA ligase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=serS PE=3 SV=1 15 427 1.0E-79
sp|Q9YAG3|SYS_AERPE Serine--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=serS PE=3 SV=2 13 427 1.0E-79
sp|Q3A8Q5|SYS_CARHZ Serine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=serS PE=3 SV=1 14 427 2.0E-79
sp|A4IJ96|SYS_GEOTN Serine--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=serS PE=3 SV=1 1 427 2.0E-79
sp|A8FAD7|SYS_BACP2 Serine--tRNA ligase OS=Bacillus pumilus (strain SAFR-032) GN=serS PE=3 SV=1 1 427 4.0E-79
sp|Q252J5|SYS_DESHY Serine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=serS PE=3 SV=1 1 427 6.0E-79
sp|B5E7F2|SYS_STRP4 Serine--tRNA ligase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=serS PE=3 SV=1 1 430 7.0E-79
sp|Q65PL0|SYS_BACLD Serine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=serS PE=3 SV=1 16 427 1.0E-78
sp|A7HN78|SYS_FERNB Serine--tRNA ligase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=serS PE=3 SV=1 14 427 1.0E-78
sp|B7IFW4|SYS_THEAB Serine--tRNA ligase OS=Thermosipho africanus (strain TCF52B) GN=serS PE=3 SV=1 14 427 3.0E-78
sp|B9K8V5|SYS_THENN Serine--tRNA ligase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=serS PE=3 SV=1 14 426 3.0E-78
sp|A5HXR1|SYS_CLOBH Serine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=serS PE=3 SV=1 21 429 4.0E-78
sp|A7FQ53|SYS_CLOB1 Serine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=serS PE=3 SV=1 21 429 4.0E-78
sp|B8FXX3|SYS_DESHD Serine--tRNA ligase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=serS PE=3 SV=1 1 427 4.0E-78
sp|A7Z0D5|SYS_BACMF Serine--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=serS PE=3 SV=1 33 427 4.0E-78
sp|B9DVD8|SYS_STRU0 Serine--tRNA ligase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=serS PE=3 SV=1 1 430 5.0E-78
sp|A4XJH1|SYS_CALS8 Serine--tRNA ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=serS PE=3 SV=1 1 427 7.0E-78
sp|B0K0Z5|SYS_THEPX Serine--tRNA ligase OS=Thermoanaerobacter sp. (strain X514) GN=serS PE=3 SV=1 1 427 1.0E-77
sp|B0KAI8|SYS_THEP3 Serine--tRNA ligase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=serS PE=3 SV=1 1 427 1.0E-77
sp|B1IDV4|SYS_CLOBK Serine--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=serS PE=3 SV=1 21 429 1.0E-77
sp|B0TAQ9|SYS_HELMI Serine--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=serS PE=3 SV=1 13 427 1.0E-77
sp|B1L1M0|SYS_CLOBM Serine--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=serS PE=3 SV=1 21 429 2.0E-77
sp|A5IMJ4|SYS_THEP1 Serine--tRNA ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=serS PE=3 SV=1 14 426 3.0E-77
sp|A7G9C5|SYS_CLOBL Serine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=serS PE=3 SV=1 21 429 4.0E-77
sp|A1TTM6|SYS_ACIAC Serine--tRNA ligase OS=Acidovorax citrulli (strain AAC00-1) GN=serS PE=3 SV=1 34 429 7.0E-77
sp|Q03MA3|SYS_STRTD Serine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=serS PE=3 SV=1 1 434 9.0E-77
sp|A0JR71|SYS_ARTS2 Serine--tRNA ligase OS=Arthrobacter sp. (strain FB24) GN=serS PE=3 SV=1 1 429 1.0E-76
sp|P37464|SYS_BACSU Serine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=serS PE=3 SV=1 33 427 2.0E-76
sp|C3NEQ7|SYS_SULIY Serine--tRNA ligase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=serS PE=3 SV=1 14 431 2.0E-76
sp|C3NGY7|SYS_SULIN Serine--tRNA ligase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=serS PE=3 SV=1 14 431 2.0E-76
sp|C3MQH9|SYS_SULIL Serine--tRNA ligase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=serS PE=3 SV=1 14 431 2.0E-76
sp|C4KHR4|SYS_SULIK Serine--tRNA ligase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=serS PE=3 SV=1 14 431 2.0E-76
sp|C3N6A0|SYS_SULIA Serine--tRNA ligase OS=Sulfolobus islandicus (strain M.16.27) GN=serS PE=3 SV=1 14 431 2.0E-76
sp|A1SD34|SYS_NOCSJ Serine--tRNA ligase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=serS PE=3 SV=1 14 427 2.0E-76
sp|C3MW57|SYS_SULIM Serine--tRNA ligase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=serS PE=3 SV=1 14 431 3.0E-76
sp|A1VH35|SYS_DESVV Serine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=serS PE=3 SV=1 14 429 3.0E-76
sp|B8DW52|SYS_BIFA0 Serine--tRNA ligase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=serS PE=3 SV=1 1 429 4.0E-76
sp|C1FPI7|SYS_CLOBJ Serine--tRNA ligase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=serS PE=3 SV=1 21 429 4.0E-76
sp|B8H9Q1|SYS_ARTCA Serine--tRNA ligase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=serS PE=3 SV=1 1 429 4.0E-76
sp|B8D3V1|SYS_DESK1 Serine--tRNA ligase OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=serS PE=3 SV=1 14 427 5.0E-76
sp|Q9X199|SYS_THEMA Serine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=serS PE=3 SV=1 14 426 7.0E-76
sp|C3KXS1|SYS_CLOB6 Serine--tRNA ligase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=serS PE=3 SV=1 21 429 9.0E-76
sp|Q9KGN4|SYS_BACHD Serine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=serS PE=3 SV=1 1 433 1.0E-75
sp|A8F3R6|SYS_PSELT Serine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=serS PE=3 SV=1 15 427 1.0E-75
sp|Q72FH6|SYS_DESVH Serine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=serS PE=3 SV=1 14 429 1.0E-75
sp|A4J0G4|SYS_DESRM Serine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=serS PE=3 SV=1 1 429 2.0E-75
sp|A9BEX3|SYS_PETMO Serine--tRNA ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=serS PE=3 SV=1 14 427 3.0E-75
sp|Q5WM19|SYS_BACSK Serine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=serS PE=3 SV=1 1 427 5.0E-75
sp|A6LJM6|SYS_THEM4 Serine--tRNA ligase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=serS PE=3 SV=1 14 427 6.0E-75
sp|B1HS47|SYS_LYSSC Serine--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=serS PE=3 SV=1 17 429 1.0E-74
sp|Q0B0Y5|SYS_SYNWW Serine--tRNA ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=serS PE=3 SV=1 31 429 1.0E-74
sp|B2J6K8|SYS_NOSP7 Serine--tRNA ligase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=serS PE=3 SV=1 14 427 1.0E-74
sp|B1LBU6|SYS_THESQ Serine--tRNA ligase OS=Thermotoga sp. (strain RQ2) GN=serS PE=3 SV=1 14 426 1.0E-74
sp|Q6A5P0|SYS_PROAC Serine--tRNA ligase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=serS PE=3 SV=1 14 429 2.0E-74
sp|Q1JKF1|SYS_STRPC Serine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=serS PE=3 SV=1 1 429 2.0E-74
sp|Q1JA99|SYS_STRPB Serine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=serS PE=3 SV=1 1 429 2.0E-74
sp|Q48RS8|SYS_STRPM Serine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=serS PE=3 SV=1 1 429 3.0E-74
sp|B4U7F1|SYS_HYDS0 Serine--tRNA ligase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=serS PE=3 SV=1 14 429 3.0E-74
sp|O33780|SYS_SULSO Serine--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=serS PE=3 SV=2 14 431 3.0E-74
sp|Q1J594|SYS_STRPF Serine--tRNA ligase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=serS PE=3 SV=1 1 429 3.0E-74
sp|B2THC5|SYS_CLOBB Serine--tRNA ligase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=serS PE=3 SV=1 14 427 3.0E-74
sp|Q8NZN7|SYS_STRP8 Serine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=serS PE=3 SV=1 1 429 3.0E-74
sp|Q5XAF1|SYS_STRP6 Serine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=serS PE=3 SV=1 1 429 3.0E-74
sp|Q99YE2|SYS_STRP1 Serine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=serS PE=3 SV=1 1 429 3.0E-74
sp|A1R120|SYS_ARTAT Serine--tRNA ligase OS=Arthrobacter aurescens (strain TC1) GN=serS PE=3 SV=1 1 429 4.0E-74
sp|P0DG57|SYS_STRPQ Serine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=serS PE=3 SV=1 1 429 5.0E-74
sp|P0DG56|SYS_STRP3 Serine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=serS PE=3 SV=1 1 429 5.0E-74
sp|Q6AH61|SYS_LEIXX Serine--tRNA ligase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=serS PE=3 SV=1 15 429 5.0E-74
sp|Q8YQ59|SYS_NOSS1 Serine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=serS PE=3 SV=1 14 427 5.0E-74
sp|Q8GMR7|SYS_SYNE7 Serine--tRNA ligase OS=Synechococcus elongatus (strain PCC 7942) GN=serS PE=3 SV=4 14 427 6.0E-74
sp|B5XHX4|SYS_STRPZ Serine--tRNA ligase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=serS PE=3 SV=1 1 429 6.0E-74
sp|Q63HF6|SYS_BACCZ Serine--tRNA ligase OS=Bacillus cereus (strain ZK / E33L) GN=serS PE=3 SV=1 43 429 6.0E-74
sp|Q1JFE4|SYS_STRPD Serine--tRNA ligase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=serS PE=3 SV=1 1 429 7.0E-74
sp|B2UX54|SYS_CLOBA Serine--tRNA ligase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=serS PE=3 SV=1 14 427 8.0E-74
sp|Q6HPZ8|SYS_BACHK Serine--tRNA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=serS PE=3 SV=1 43 429 9.0E-74
sp|C1ES19|SYS_BACC3 Serine--tRNA ligase OS=Bacillus cereus (strain 03BB102) GN=serS PE=3 SV=1 43 429 9.0E-74
sp|B7JJC8|SYS_BACC0 Serine--tRNA ligase OS=Bacillus cereus (strain AH820) GN=serS PE=3 SV=1 43 429 9.0E-74
sp|Q81W25|SYS_BACAN Serine--tRNA ligase OS=Bacillus anthracis GN=serS PE=3 SV=1 43 429 9.0E-74
sp|A0R891|SYS_BACAH Serine--tRNA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=serS PE=3 SV=1 43 429 9.0E-74
sp|C3LIY9|SYS_BACAC Serine--tRNA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=serS PE=3 SV=1 43 429 9.0E-74
sp|C3P9G2|SYS_BACAA Serine--tRNA ligase OS=Bacillus anthracis (strain A0248) GN=serS PE=3 SV=1 43 429 9.0E-74
sp|B1I161|SYS_DESAP Serine--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=serS PE=3 SV=1 15 429 1.0E-73
sp|Q81JC4|SYS_BACCR Serine--tRNA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=serS PE=3 SV=1 43 429 1.0E-73
sp|B7HII5|SYS_BACC4 Serine--tRNA ligase OS=Bacillus cereus (strain B4264) GN=serS PE=3 SV=1 43 429 1.0E-73
sp|B7IS31|SYS_BACC2 Serine--tRNA ligase OS=Bacillus cereus (strain G9842) GN=serS PE=3 SV=1 43 429 1.0E-73
sp|Q3MCE0|SYS_ANAVT Serine--tRNA ligase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=serS PE=3 SV=1 14 427 1.0E-73
sp|B9IYI0|SYS_BACCQ Serine--tRNA ligase OS=Bacillus cereus (strain Q1) GN=serS PE=3 SV=1 43 429 1.0E-73
sp|B7HPS8|SYS_BACC7 Serine--tRNA ligase OS=Bacillus cereus (strain AH187) GN=serS PE=3 SV=1 43 429 1.0E-73
sp|A7GJT0|SYS_BACCN Serine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=serS PE=3 SV=1 43 429 1.0E-73
sp|Q73FJ3|SYS_BACC1 Serine--tRNA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=serS PE=3 SV=1 43 429 1.0E-73
sp|Q8RDJ5|SYS_CALS4 Serine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=serS PE=3 SV=1 40 427 2.0E-73
sp|A7GWY9|SYS_CAMC5 Serine--tRNA ligase OS=Campylobacter curvus (strain 525.92) GN=serS PE=3 SV=1 23 427 2.0E-73
sp|Q0TV53|SYS_CLOP1 Serine--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=serS PE=3 SV=1 21 427 2.0E-73
sp|A5N469|SYS_CLOK5 Serine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=serS PE=3 SV=1 14 429 2.0E-73
sp|B9DXT9|SYS_CLOK1 Serine--tRNA ligase OS=Clostridium kluyveri (strain NBRC 12016) GN=serS PE=3 SV=1 14 429 2.0E-73
sp|A7ZBR7|SYS_CAMC1 Serine--tRNA ligase OS=Campylobacter concisus (strain 13826) GN=serS PE=3 SV=1 25 427 2.0E-73
sp|Q8XPE9|SYS_CLOPE Serine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=serS PE=3 SV=2 21 427 2.0E-73
sp|A0AM81|SYS_LISW6 Serine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=serS PE=3 SV=1 52 429 2.0E-73
sp|Q1H290|SYS_METFK Serine--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=serS PE=3 SV=1 32 429 3.0E-73
sp|Q0SWW9|SYS_CLOPS Serine--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=serS PE=3 SV=1 21 427 3.0E-73
sp|Q8RH11|SYS_FUSNN Serine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=serS PE=3 SV=2 16 429 3.0E-73
sp|C4L937|SYS_TOLAT Serine--tRNA ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=serS PE=3 SV=1 36 429 4.0E-73
sp|Q82YY9|SYS2_ENTFA Serine--tRNA ligase 2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=serS2 PE=3 SV=1 16 427 6.0E-73
sp|A0LWR6|SYS_ACIC1 Serine--tRNA ligase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=serS PE=3 SV=1 14 427 7.0E-73
sp|A1VYA9|SYS_CAMJJ Serine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=serS PE=3 SV=1 1 427 7.0E-73
sp|A2RCY1|SYS_STRPG Serine--tRNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=serS PE=3 SV=1 1 429 7.0E-73
sp|C1DKY8|SYS_AZOVD Serine--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=serS PE=3 SV=1 51 429 8.0E-73
sp|Q8DSB7|SYS_STRMU Serine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=serS PE=3 SV=1 1 429 9.0E-73
sp|Q39PU1|SYS_GEOMG Serine--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=serS PE=3 SV=1 68 429 9.0E-73
sp|A9AES3|SYS_BURM1 Serine--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=serS PE=3 SV=1 1 429 1.0E-72
sp|Q9AEN2|SYS_BURCE Serine--tRNA ligase OS=Burkholderia cepacia GN=serS PE=3 SV=1 1 429 1.0E-72
sp|B2VA33|SYS_SULSY Serine--tRNA ligase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=serS PE=3 SV=1 14 427 1.0E-72
sp|P67566|SYS_STRA5 Serine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=serS PE=3 SV=1 42 427 1.0E-72
sp|P67565|SYS_STRA3 Serine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=serS PE=3 SV=1 42 427 1.0E-72
sp|Q3K326|SYS_STRA1 Serine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=serS PE=3 SV=1 42 427 1.0E-72
sp|Q041F5|SYS_LACGA Serine--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=serS PE=3 SV=1 25 429 2.0E-72
sp|B9MEG7|SYS_ACIET Serine--tRNA ligase OS=Acidovorax ebreus (strain TPSY) GN=serS PE=3 SV=1 32 429 2.0E-72
sp|A8ZXS1|SYS_DESOH Serine--tRNA ligase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=serS PE=3 SV=1 1 427 2.0E-72
sp|Q39IN7|SYS_BURL3 Serine--tRNA ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=serS PE=3 SV=1 1 429 2.0E-72
sp|Q8EU77|SYS_OCEIH Serine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=serS PE=3 SV=1 16 429 2.0E-72
sp|Q47TZ5|SYS_THEFY Serine--tRNA ligase OS=Thermobifida fusca (strain YX) GN=serS PE=3 SV=1 14 427 3.0E-72
sp|Q8ZTP4|SYS_PYRAE Serine--tRNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=serS PE=3 SV=1 15 427 3.0E-72
sp|Q2SY90|SYS_BURTA Serine--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=serS PE=3 SV=1 1 429 3.0E-72
sp|Q8Y3T4|SYS_LISMO Serine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=serS PE=3 SV=1 52 429 3.0E-72
sp|Q9PIB3|SYS_CAMJE Serine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=serS PE=3 SV=1 1 427 4.0E-72
sp|B8DD73|SYS_LISMH Serine--tRNA ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=serS PE=3 SV=1 52 429 5.0E-72
sp|Q71W17|SYS_LISMF Serine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=serS PE=3 SV=1 52 429 5.0E-72
sp|C1L082|SYS_LISMC Serine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=serS PE=3 SV=1 52 429 5.0E-72
sp|C5CWN5|SYS_VARPS Serine--tRNA ligase OS=Variovorax paradoxus (strain S110) GN=serS PE=3 SV=1 22 429 5.0E-72
sp|B4U1C3|SYS_STREM Serine--tRNA ligase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=serS PE=3 SV=1 1 429 6.0E-72
sp|A1WBD4|SYS_ACISJ Serine--tRNA ligase OS=Acidovorax sp. (strain JS42) GN=serS PE=3 SV=1 32 429 6.0E-72
sp|Q926Z9|SYS_LISIN Serine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=serS PE=3 SV=1 52 429 7.0E-72
sp|B9L7B0|SYS_NAUPA Serine--tRNA ligase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=serS PE=3 SV=1 32 427 8.0E-72
sp|A3NCC8|SYS_BURP6 Serine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=serS PE=3 SV=1 1 429 1.0E-71
sp|B2GGG9|SYS_KOCRD Serine--tRNA ligase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=serS PE=3 SV=1 1 429 1.0E-71
sp|Q63RS1|SYS_BURPS Serine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=serS PE=3 SV=1 1 429 1.0E-71
sp|Q3JPQ8|SYS_BURP1 Serine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=serS PE=3 SV=1 1 429 1.0E-71
sp|A3NY56|SYS_BURP0 Serine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=serS PE=3 SV=1 1 429 1.0E-71
sp|A1V1N6|SYS_BURMS Serine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=serS PE=3 SV=1 1 429 1.0E-71
sp|Q62HY1|SYS_BURMA Serine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=serS PE=3 SV=1 1 429 1.0E-71
sp|A2S9G4|SYS_BURM9 Serine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=serS PE=3 SV=1 1 429 1.0E-71
sp|A3MMN2|SYS_BURM7 Serine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=serS PE=3 SV=1 1 429 1.0E-71
sp|A6SX50|SYS_JANMA Serine--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=serS PE=3 SV=1 37 429 1.0E-71
sp|Q0BHH5|SYS_BURCM Serine--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=serS PE=3 SV=1 1 429 2.0E-71
sp|A0RQK5|SYS_CAMFF Serine--tRNA ligase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=serS PE=3 SV=1 57 427 2.0E-71
sp|C6BS43|SYS_DESAD Serine--tRNA ligase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=serS PE=3 SV=1 18 429 2.0E-71
sp|C0M858|SYS_STRE4 Serine--tRNA ligase OS=Streptococcus equi subsp. equi (strain 4047) GN=serS PE=3 SV=1 1 429 2.0E-71
sp|A4G3W7|SYS_HERAR Serine--tRNA ligase OS=Herminiimonas arsenicoxydans GN=serS PE=3 SV=1 32 442 2.0E-71
sp|B9KFN2|SYS_CAMLR Serine--tRNA ligase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=serS PE=3 SV=1 57 427 2.0E-71
sp|C5BWI5|SYS_BEUC1 Serine--tRNA ligase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=serS PE=3 SV=1 14 429 2.0E-71
sp|C3JY54|SYS_PSEFS Serine--tRNA ligase OS=Pseudomonas fluorescens (strain SBW25) GN=serS PE=3 SV=1 36 429 2.0E-71
sp|Q899T6|SYS_CLOTE Serine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=serS PE=3 SV=1 14 429 2.0E-71
sp|A8FKH6|SYS_CAMJ8 Serine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=serS PE=3 SV=1 1 427 3.0E-71
sp|A1S6H5|SYS_SHEAM Serine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=serS PE=3 SV=1 32 429 3.0E-71
sp|Q3KA84|SYS_PSEPF Serine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=serS PE=3 SV=1 36 429 3.0E-71
sp|B1Y9Y4|SYS_PYRNV Serine--tRNA ligase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=serS PE=3 SV=1 14 427 3.0E-71
sp|A6TJ99|SYS_ALKMQ Serine--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=serS PE=3 SV=1 16 429 4.0E-71
sp|A7H4Y8|SYS_CAMJD Serine--tRNA ligase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=serS PE=3 SV=1 80 427 4.0E-71
sp|Q2KWF5|SYS_BORA1 Serine--tRNA ligase OS=Bordetella avium (strain 197N) GN=serS PE=3 SV=1 44 429 4.0E-71
sp|C5C878|SYS_MICLC Serine--tRNA ligase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=serS PE=3 SV=1 1 433 4.0E-71
sp|B2T1A6|SYS_BURPP Serine--tRNA ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=serS PE=3 SV=1 1 429 4.0E-71
sp|C0ME07|SYS_STRS7 Serine--tRNA ligase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=serS PE=3 SV=1 37 429 5.0E-71
sp|B7JY63|SYS_CYAP8 Serine--tRNA ligase OS=Cyanothece sp. (strain PCC 8801) GN=serS PE=3 SV=1 14 427 5.0E-71
sp|Q65SK3|SYS_MANSM Serine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=serS PE=3 SV=1 14 429 5.0E-71
sp|B4EBR4|SYS_BURCJ Serine--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=serS PE=3 SV=1 1 429 5.0E-71
sp|Q74HZ5|SYS_LACJO Serine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=serS PE=3 SV=1 25 429 6.0E-71
sp|Q9I0M6|SYS_PSEAE Serine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=serS PE=3 SV=1 14 429 7.0E-71
sp|Q02NA4|SYS_PSEAB Serine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=serS PE=3 SV=1 14 429 7.0E-71
sp|B7UW10|SYS_PSEA8 Serine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=serS PE=3 SV=1 14 429 7.0E-71
sp|Q316Z9|SYS_DESAG Serine--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=serS PE=3 SV=1 14 429 7.0E-71
sp|Q74H55|SYS_GEOSL Serine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=serS PE=3 SV=1 50 429 8.0E-71
sp|A0K5F5|SYS_BURCH Serine--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=serS PE=3 SV=1 1 429 8.0E-71
sp|Q21TF1|SYS_RHOFT Serine--tRNA ligase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=serS PE=3 SV=1 1 429 9.0E-71
sp|Q143D9|SYS_BURXL Serine--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=serS PE=3 SV=1 1 429 1.0E-70
sp|Q5HW78|SYS_CAMJR Serine--tRNA ligase OS=Campylobacter jejuni (strain RM1221) GN=serS PE=3 SV=1 1 427 1.0E-70
sp|B2A2Z8|SYS_NATTJ Serine--tRNA ligase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=serS PE=3 SV=1 32 429 1.0E-70
sp|B5Y8D8|SYS_COPPD Serine--tRNA ligase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=serS PE=3 SV=1 18 427 1.0E-70
sp|A1K581|SYS_AZOSB Serine--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=serS PE=3 SV=1 37 429 1.0E-70
sp|B1YUL5|SYS_BURA4 Serine--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=serS PE=3 SV=1 1 429 2.0E-70
sp|B0UUT7|SYS_HISS2 Serine--tRNA ligase OS=Histophilus somni (strain 2336) GN=serS PE=3 SV=1 17 429 2.0E-70
sp|B2GF13|SYS_LACF3 Serine--tRNA ligase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=serS PE=3 SV=1 15 439 2.0E-70
sp|B0JTT9|SYS_MICAN Serine--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=serS PE=3 SV=1 14 427 2.0E-70
sp|Q3A7Q8|SYS_PELCD Serine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=serS PE=3 SV=1 41 429 2.0E-70
sp|B7GN83|SYS_BIFLS Serine--tRNA ligase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=serS PE=3 SV=1 1 429 2.0E-70
sp|A4JCA3|SYS_BURVG Serine--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=serS PE=3 SV=1 1 429 2.0E-70
sp|C1DBY7|SYS_LARHH Serine--tRNA ligase OS=Laribacter hongkongensis (strain HLHK9) GN=serS PE=3 SV=1 34 429 2.0E-70
sp|P26636|SYSC_CRIGR Serine--tRNA ligase, cytoplasmic (Fragment) OS=Cricetulus griseus GN=SARS PE=2 SV=1 277 449 2.0E-70
sp|B3DQG7|SYS_BIFLD Serine--tRNA ligase OS=Bifidobacterium longum (strain DJO10A) GN=serS PE=3 SV=1 1 429 2.0E-70
sp|A6V4H5|SYS_PSEA7 Serine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=serS PE=3 SV=1 14 429 3.0E-70
sp|Q4K9V7|SYS_PSEF5 Serine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=serS PE=3 SV=1 36 429 3.0E-70
sp|B2G575|SYS_LACRJ Serine--tRNA ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=serS PE=3 SV=1 14 439 3.0E-70
sp|A5VHP5|SYS_LACRD Serine--tRNA ligase OS=Lactobacillus reuteri (strain DSM 20016) GN=serS PE=3 SV=1 14 439 3.0E-70
sp|B8HL86|SYS_CYAP4 Serine--tRNA ligase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=serS PE=3 SV=1 35 427 3.0E-70
sp|Q8G3W7|SYS_BIFLO Serine--tRNA ligase OS=Bifidobacterium longum (strain NCC 2705) GN=serS PE=3 SV=1 1 429 4.0E-70
sp|Q6AMD2|SYS_DESPS Serine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=serS PE=3 SV=1 18 427 4.0E-70
sp|B1JX98|SYS_BURCC Serine--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=serS PE=3 SV=1 1 429 4.0E-70
sp|Q67TJ8|SYS_SYMTH Serine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=serS PE=3 SV=1 14 426 4.0E-70
sp|Q03ZQ9|SYS_LEUMM Serine--tRNA ligase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=serS PE=3 SV=1 25 429 6.0E-70
sp|B2JEF5|SYS_BURP8 Serine--tRNA ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=serS PE=3 SV=1 1 429 6.0E-70
sp|Q0I471|SYS_HAES1 Serine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=serS PE=3 SV=1 39 429 7.0E-70
sp|Q839Q8|SYS1_ENTFA Serine--tRNA ligase 1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=serS1 PE=3 SV=1 16 429 8.0E-70
sp|A2RJ76|SYS_LACLM Serine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=serS PE=3 SV=1 1 429 1.0E-69
sp|C6E7Z3|SYS_GEOSM Serine--tRNA ligase OS=Geobacter sp. (strain M21) GN=serS PE=3 SV=1 78 430 1.0E-69
sp|Q02XG6|SYS_LACLS Serine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=serS PE=3 SV=1 1 429 1.0E-69
sp|Q8DIN0|SYS_THEEB Serine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=serS PE=3 SV=1 14 427 1.0E-69
sp|A5W1H6|SYS_PSEP1 Serine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=serS PE=3 SV=1 13 429 1.0E-69
sp|B0SRZ1|SYS_LEPBP Serine--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=serS PE=3 SV=1 1 427 1.0E-69
sp|B0S8Z4|SYS_LEPBA Serine--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=serS PE=3 SV=1 1 427 1.0E-69
sp|A1WP10|SYS_VEREI Serine--tRNA ligase OS=Verminephrobacter eiseniae (strain EF01-2) GN=serS PE=3 SV=1 39 429 1.0E-69
sp|Q048F6|SYS_LACDB Serine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=serS PE=3 SV=1 25 429 1.0E-69
sp|Q1G8N2|SYS_LACDA Serine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=serS PE=3 SV=1 25 429 1.0E-69
sp|B8DQP8|SYS_DESVM Serine--tRNA ligase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=serS PE=3 SV=1 15 429 1.0E-69
sp|B7KCF5|SYS_CYAP7 Serine--tRNA ligase OS=Cyanothece sp. (strain PCC 7424) GN=serS PE=3 SV=1 1 427 2.0E-69
sp|B3EAQ9|SYS_GEOLS Serine--tRNA ligase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=serS PE=3 SV=1 1 429 3.0E-69
sp|Q9CEX2|SYS_LACLA Serine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=serS PE=3 SV=1 1 429 3.0E-69
sp|A2BXQ6|SYS_PROM5 Serine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9515) GN=serS PE=3 SV=1 68 430 3.0E-69
sp|A9M1Q6|SYS_NEIM0 Serine--tRNA ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=serS PE=3 SV=1 37 429 3.0E-69
sp|A1A0B7|SYS_BIFAA Serine--tRNA ligase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=serS PE=3 SV=1 1 429 3.0E-69
sp|Q88XZ7|SYS2_LACPL Serine--tRNA ligase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=serS2 PE=3 SV=1 14 429 3.0E-69
sp|Q38UM4|SYS_LACSS Serine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=serS PE=3 SV=1 19 429 4.0E-69
sp|A3PE37|SYS_PROM0 Serine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=serS PE=3 SV=1 43 435 4.0E-69
sp|A3MX52|SYS_PYRCJ Serine--tRNA ligase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=serS PE=3 SV=1 15 427 4.0E-69
sp|Q88FT2|SYS_PSEPK Serine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=serS PE=3 SV=1 13 429 4.0E-69
sp|A0L6J8|SYS_MAGMM Serine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=serS PE=3 SV=1 1 429 4.0E-69
sp|Q8TIU3|SYS_METAC Serine--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=serS PE=3 SV=1 14 429 6.0E-69
sp|A3N0M8|SYS_ACTP2 Serine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=serS PE=3 SV=1 32 429 6.0E-69
sp|A1RRX4|SYS_PYRIL Serine--tRNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=serS PE=3 SV=1 14 427 7.0E-69
sp|Q7VM65|SYS_HAEDU Serine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=serS PE=3 SV=1 32 429 8.0E-69
sp|A1ALM7|SYS_PELPD Serine--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=serS PE=3 SV=1 57 429 9.0E-69
sp|Q3AV47|SYS_SYNS9 Serine--tRNA ligase OS=Synechococcus sp. (strain CC9902) GN=serS PE=3 SV=1 14 427 9.0E-69
sp|B0BPF3|SYS_ACTPJ Serine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=serS PE=3 SV=1 32 429 9.0E-69
sp|B3H1K7|SYS_ACTP7 Serine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=serS PE=3 SV=1 32 429 9.0E-69
sp|Q9JY95|SYS_NEIMB Serine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=serS PE=3 SV=1 38 429 9.0E-69
sp|A0KJE8|SYS_AERHH Serine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=serS PE=3 SV=1 32 429 9.0E-69
sp|A9BYK5|SYS_DELAS Serine--tRNA ligase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=serS PE=3 SV=1 1 429 9.0E-69
sp|B5E8F6|SYS_GEOBB Serine--tRNA ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=serS PE=3 SV=1 78 430 1.0E-68
sp|Q1WVB3|SYS_LACS1 Serine--tRNA ligase OS=Lactobacillus salivarius (strain UCC118) GN=serS PE=3 SV=1 1 429 1.0E-68
sp|A4XUX4|SYS_PSEMY Serine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=serS PE=3 SV=1 37 429 1.0E-68
sp|A1VSK4|SYS_POLNA Serine--tRNA ligase OS=Polaromonas naphthalenivorans (strain CJ2) GN=serS PE=3 SV=1 1 429 1.0E-68
sp|B2KEV5|SYS_ELUMP Serine--tRNA ligase OS=Elusimicrobium minutum (strain Pei191) GN=serS PE=3 SV=1 1 427 1.0E-68
sp|Q0VQ06|SYS_ALCBS Serine--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=serS PE=3 SV=1 14 429 1.0E-68
sp|Q2JKN4|SYS_SYNJB Serine--tRNA ligase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=serS PE=3 SV=1 1 427 1.0E-68
sp|B1Y0I6|SYS_LEPCP Serine--tRNA ligase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=serS PE=3 SV=1 24 429 2.0E-68
sp|A4SNK6|SYS_AERS4 Serine--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=serS PE=3 SV=1 14 429 2.0E-68
sp|Q6F2A0|SYS_MESFL Serine--tRNA ligase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=serS PE=3 SV=1 1 427 2.0E-68
sp|B0KLW8|SYS_PSEPG Serine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=serS PE=3 SV=1 13 429 2.0E-68
sp|Q820S5|SYS_NITEU Serine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=serS PE=3 SV=1 39 429 2.0E-68
sp|Q83FJ7|SYS_TROWT Serine--tRNA ligase OS=Tropheryma whipplei (strain Twist) GN=serS PE=3 SV=1 15 427 3.0E-68
sp|A8G5Y6|SYS_PROM2 Serine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9215) GN=serS PE=3 SV=1 14 435 3.0E-68
sp|A4VLU7|SYS_PSEU5 Serine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=serS PE=3 SV=1 36 429 3.0E-68
sp|A5UYX1|SYS_ROSS1 Serine--tRNA ligase OS=Roseiflexus sp. (strain RS-1) GN=serS PE=3 SV=1 15 429 3.0E-68
sp|Q7NY99|SYS_CHRVO Serine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=serS PE=3 SV=1 39 427 3.0E-68
sp|Q8PYJ6|SYS_METMA Serine--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=serS PE=3 SV=1 14 430 3.0E-68
sp|Q5FIN5|SYS_LACAC Serine--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=serS PE=3 SV=1 25 439 4.0E-68
sp|B0TUP4|SYS_SHEHH Serine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=serS PE=3 SV=1 34 429 5.0E-68
sp|Q7V0R7|SYS_PROMP Serine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=serS PE=3 SV=1 98 437 5.0E-68
sp|Q1AX26|SYS_RUBXD Serine--tRNA ligase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=serS PE=3 SV=1 29 427 5.0E-68
sp|A1KV93|SYS_NEIMF Serine--tRNA ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=serS PE=3 SV=1 37 429 5.0E-68
sp|Q2RMH8|SYS_MOOTA Serine--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=serS PE=3 SV=1 14 429 5.0E-68
sp|Q46F20|SYS_METBF Serine--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=serS1 PE=1 SV=2 15 430 5.0E-68
sp|Q83HA1|SYS_TROW8 Serine--tRNA ligase OS=Tropheryma whipplei (strain TW08/27) GN=serS PE=3 SV=1 15 427 5.0E-68
sp|B8CP82|SYS_SHEPW Serine--tRNA ligase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=serS PE=3 SV=1 32 429 6.0E-68
sp|A2BSA4|SYS_PROMS Serine--tRNA ligase OS=Prochlorococcus marinus (strain AS9601) GN=serS PE=3 SV=1 53 427 6.0E-68
sp|B2HMM1|SYS_MYCMM Serine--tRNA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=serS PE=3 SV=1 14 427 6.0E-68
sp|Q5F752|SYS_NEIG1 Serine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=serS PE=3 SV=1 37 429 6.0E-68
sp|A6T6Z0|SYS_KLEP7 Serine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=serS PE=3 SV=1 1 429 7.0E-68
sp|B8F4Q5|SYS_HAEPS Serine--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=serS PE=3 SV=1 24 429 7.0E-68
sp|Q8RWT8|SYSM_ARATH Serine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=OVA7 PE=2 SV=1 16 429 8.0E-68
sp|A8YWU9|SYS_LACH4 Serine--tRNA ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=serS PE=3 SV=1 25 439 1.0E-67
sp|A7HZX6|SYS_CAMHC Serine--tRNA ligase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=serS PE=3 SV=1 53 427 1.0E-67
sp|B5XY99|SYS_KLEP3 Serine--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=serS PE=3 SV=1 1 429 1.0E-67
sp|Q1IBD0|SYS_PSEE4 Serine--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=serS PE=3 SV=1 36 429 1.0E-67
sp|B4RN50|SYS_NEIG2 Serine--tRNA ligase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=serS PE=3 SV=1 37 429 1.0E-67
sp|Q0KDK9|SYS_CUPNH Serine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=serS PE=3 SV=1 37 429 1.0E-67
sp|A6QBP2|SYS_SULNB Serine--tRNA ligase OS=Sulfurovum sp. (strain NBC37-1) GN=serS PE=3 SV=1 38 427 1.0E-67
sp|B8FNA6|SYS_DESAA Serine--tRNA ligase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=serS PE=3 SV=1 35 429 2.0E-67
sp|C0QLD3|SYS_DESAH Serine--tRNA ligase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=serS PE=3 SV=1 57 429 2.0E-67
sp|B3PL38|SYS_CELJU Serine--tRNA ligase OS=Cellvibrio japonicus (strain Ueda107) GN=serS PE=3 SV=1 32 429 2.0E-67
sp|A5EXS3|SYS_DICNV Serine--tRNA ligase OS=Dichelobacter nodosus (strain VCS1703A) GN=serS PE=3 SV=1 39 429 2.0E-67
sp|B8E0R9|SYS_DICTD Serine--tRNA ligase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=serS PE=3 SV=1 14 427 3.0E-67
sp|A5WFN9|SYS_PSYWF Serine--tRNA ligase OS=Psychrobacter sp. (strain PRwf-1) GN=serS PE=3 SV=1 52 430 4.0E-67
sp|Q30PY7|SYS_SULDN Serine--tRNA ligase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=serS PE=3 SV=1 14 427 4.0E-67
sp|B7I6V5|SYS_ACIB5 Serine--tRNA ligase OS=Acinetobacter baumannii (strain AB0057) GN=serS PE=3 SV=1 14 430 4.0E-67
sp|B7GXI2|SYS_ACIB3 Serine--tRNA ligase OS=Acinetobacter baumannii (strain AB307-0294) GN=serS PE=3 SV=1 14 430 4.0E-67
sp|B2UPP6|SYS_AKKM8 Serine--tRNA ligase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=serS PE=3 SV=1 14 427 5.0E-67
sp|Q0AJC4|SYS_NITEC Serine--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=serS PE=3 SV=1 1 429 5.0E-67
sp|A5GD47|SYS_GEOUR Serine--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=serS PE=3 SV=1 57 429 5.0E-67
sp|A8FV67|SYS_SHESH Serine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=serS PE=3 SV=1 31 429 5.0E-67
sp|B8J4S2|SYS_DESDA Serine--tRNA ligase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=serS PE=3 SV=1 15 429 6.0E-67
sp|Q3SJH9|SYS_THIDA Serine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=serS PE=3 SV=1 39 429 6.0E-67
sp|B2HXU5|SYS_ACIBC Serine--tRNA ligase OS=Acinetobacter baumannii (strain ACICU) GN=serS PE=3 SV=1 14 430 8.0E-67
sp|A0LI63|SYS_SYNFM Serine--tRNA ligase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=serS PE=3 SV=1 1 427 9.0E-67
sp|Q31HK9|SYS_THICR Serine--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=serS PE=3 SV=1 51 429 9.0E-67
sp|Q8FLY5|SYS_COREF Serine--tRNA ligase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=serS PE=3 SV=2 1 427 9.0E-67
sp|Q9JT77|SYS_NEIMA Serine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=serS PE=3 SV=1 37 429 1.0E-66
sp|B1JBE0|SYS_PSEPW Serine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=serS PE=3 SV=1 13 429 1.0E-66
sp|B9L131|SYS_THERP Serine--tRNA ligase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=serS PE=3 SV=1 15 429 2.0E-66
sp|Q6F8G5|SYS_ACIAD Serine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=serS PE=3 SV=2 37 430 2.0E-66
sp|Q0A7Z2|SYS_ALKEH Serine--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=serS PE=3 SV=1 14 429 3.0E-66
sp|A3QEI8|SYS_SHELP Serine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=serS PE=3 SV=1 32 429 3.0E-66
sp|A6Q4S8|SYS_NITSB Serine--tRNA ligase OS=Nitratiruptor sp. (strain SB155-2) GN=serS PE=3 SV=1 31 427 3.0E-66
sp|Q87ZS9|SYS_PSESM Serine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=serS PE=3 SV=1 36 429 3.0E-66
sp|Q5NXU8|SYS_AROAE Serine--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=serS PE=3 SV=1 39 429 4.0E-66
sp|A4W8R7|SYS_ENT38 Serine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=serS PE=3 SV=1 14 429 4.0E-66
sp|A6VNC3|SYS_ACTSZ Serine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=serS PE=3 SV=1 14 427 4.0E-66
sp|Q48H74|SYS_PSE14 Serine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=serS PE=3 SV=1 36 429 4.0E-66
sp|Q7UXX6|SYS_RHOBA Serine--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=serS PE=3 SV=2 18 427 5.0E-66
sp|Q083B6|SYS_SHEFN Serine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=serS PE=3 SV=1 32 429 6.0E-66
sp|A7NJB8|SYS_ROSCS Serine--tRNA ligase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=serS PE=3 SV=1 15 430 6.0E-66
sp|Q12NE5|SYS_SHEDO Serine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=serS PE=3 SV=1 38 430 6.0E-66
sp|B2U9Y5|SYS_RALPJ Serine--tRNA ligase OS=Ralstonia pickettii (strain 12J) GN=serS PE=3 SV=1 37 429 7.0E-66
sp|C1B914|SYS_RHOOB Serine--tRNA ligase OS=Rhodococcus opacus (strain B4) GN=serS PE=3 SV=1 14 427 8.0E-66
sp|Q4ZRL5|SYS_PSEU2 Serine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=serS PE=3 SV=1 36 429 9.0E-66
sp|Q6NEN2|SYS_CORDI Serine--tRNA ligase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=serS PE=3 SV=1 14 427 9.0E-66
sp|A0PX13|SYS_MYCUA Serine--tRNA ligase OS=Mycobacterium ulcerans (strain Agy99) GN=serS PE=3 SV=1 14 427 9.0E-66
sp|A1SVE4|SYS_PSYIN Serine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=serS PE=3 SV=1 18 429 1.0E-65
sp|Q4FR92|SYS_PSYA2 Serine--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=serS PE=3 SV=1 51 434 1.0E-65
sp|B3W8V7|SYS_LACCB Serine--tRNA ligase OS=Lactobacillus casei (strain BL23) GN=serS PE=3 SV=1 15 435 1.0E-65
sp|Q1LQJ5|SYS_CUPMC Serine--tRNA ligase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=serS PE=3 SV=1 36 429 1.0E-65
sp|Q1Q9M6|SYS_PSYCK Serine--tRNA ligase OS=Psychrobacter cryohalolentis (strain K5) GN=serS PE=3 SV=1 51 430 1.0E-65
sp|Q10YR2|SYS_TRIEI Serine--tRNA ligase OS=Trichodesmium erythraeum (strain IMS101) GN=serS PE=3 SV=1 1 427 2.0E-65
sp|B6IZT4|SYS_COXB2 Serine--tRNA ligase OS=Coxiella burnetii (strain CbuG_Q212) GN=serS PE=3 SV=1 16 429 2.0E-65
sp|Q037M7|SYS_LACC3 Serine--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=serS PE=3 SV=1 15 435 2.0E-65
sp|A9KFP4|SYS_COXBN Serine--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=serS PE=3 SV=1 16 429 2.0E-65
sp|B2TUI5|SYS_SHIB3 Serine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=serS PE=3 SV=1 14 429 2.0E-65
sp|Q2JXL1|SYS_SYNJA Serine--tRNA ligase OS=Synechococcus sp. (strain JA-3-3Ab) GN=serS PE=3 SV=1 1 427 2.0E-65
sp|A9MHZ1|SYS_SALAR Serine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=serS PE=3 SV=1 14 429 2.0E-65
sp|B7LN61|SYS_ESCF3 Serine--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=serS PE=3 SV=1 14 429 2.0E-65
sp|B4S6M3|SYS_PROA2 Serine--tRNA ligase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=serS PE=3 SV=1 1 426 3.0E-65
sp|Q21K22|SYS_SACD2 Serine--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|P43833|SYS_HAEIN Serine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=serS PE=3 SV=1 28 429 3.0E-65
sp|Q5ZY59|SYS_LEGPH Serine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=serS PE=3 SV=1 38 429 3.0E-65
sp|Q4QP70|SYS_HAEI8 Serine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=serS PE=3 SV=1 28 429 3.0E-65
sp|B5EMC5|SYS_ACIF5 Serine--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=serS PE=3 SV=1 15 429 3.0E-65
sp|B7J4C9|SYS_ACIF2 Serine--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=serS PE=3 SV=1 15 429 3.0E-65
sp|P39919|SYS_COXBU Serine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=serS PE=3 SV=1 16 429 3.0E-65
sp|A9NDR1|SYS_COXBR Serine--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=serS PE=3 SV=1 16 429 3.0E-65
sp|Q3Z3M7|SYS_SHISS Serine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|P0A8L4|SYS_SHIFL Serine--tRNA ligase OS=Shigella flexneri GN=serS PE=3 SV=1 14 429 3.0E-65
sp|Q0T8M9|SYS_SHIF8 Serine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|Q323L0|SYS_SHIBS Serine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|Q1RE21|SYS_ECOUT Serine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|B1LJX0|SYS_ECOSM Serine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|B6I8W4|SYS_ECOSE Serine--tRNA ligase OS=Escherichia coli (strain SE11) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|B7NAP4|SYS_ECOLU Serine--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|P0A8L1|SYS_ECOLI Serine--tRNA ligase OS=Escherichia coli (strain K12) GN=serS PE=1 SV=1 14 429 3.0E-65
sp|B1IWN0|SYS_ECOLC Serine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|P0A8L2|SYS_ECOL6 Serine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|Q0TJF7|SYS_ECOL5 Serine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|A1A9D6|SYS_ECOK1 Serine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=serS PE=3 SV=1 14 429 3.0E-65
sp|A7ZYJ7|SYS_ECOHS Serine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|B1X833|SYS_ECODH Serine--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|C4ZQ19|SYS_ECOBW Serine--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|B7M821|SYS_ECO8A Serine--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|B7MRV6|SYS_ECO81 Serine--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|B7NM82|SYS_ECO7I Serine--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|B5YT28|SYS_ECO5E Serine--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|P0A8L3|SYS_ECO57 Serine--tRNA ligase OS=Escherichia coli O157:H7 GN=serS PE=3 SV=1 14 429 3.0E-65
sp|B7LD85|SYS_ECO55 Serine--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|B7MHK5|SYS_ECO45 Serine--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|B7UMY4|SYS_ECO27 Serine--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|A7ZJW2|SYS_ECO24 Serine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=serS PE=3 SV=1 14 429 3.0E-65
sp|A8MEB3|SYS_ALKOO Serine--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=serS PE=3 SV=1 16 429 3.0E-65
sp|A7MER7|SYS_CROS8 Serine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=serS PE=3 SV=1 1 429 4.0E-65
sp|A8H4R2|SYS_SHEPA Serine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=serS PE=3 SV=1 34 429 4.0E-65
sp|A2SJA7|SYS_METPP Serine--tRNA ligase OS=Methylibium petroleiphilum (strain PM1) GN=serS PE=3 SV=1 1 429 4.0E-65
sp|A5IH84|SYS_LEGPC Serine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=serS PE=3 SV=1 38 429 4.0E-65
sp|Q5X7N0|SYS_LEGPA Serine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=serS PE=3 SV=1 38 429 5.0E-65
sp|Q024V4|SYS_SOLUE Serine--tRNA ligase OS=Solibacter usitatus (strain Ellin6076) GN=serS PE=3 SV=1 42 427 5.0E-65
sp|B4SF71|SYS_PELPB Serine--tRNA ligase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=serS PE=3 SV=1 1 426 5.0E-65
sp|B8G8S1|SYS_CHLAD Serine--tRNA ligase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=serS PE=3 SV=1 15 429 6.0E-65
sp|Q47GH9|SYS_DECAR Serine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=serS PE=3 SV=1 39 429 6.0E-65
sp|B6J7K7|SYS_COXB1 Serine--tRNA ligase OS=Coxiella burnetii (strain CbuK_Q154) GN=serS PE=3 SV=1 16 429 7.0E-65
sp|Q11HC8|SYS_CHESB Serine--tRNA ligase OS=Chelativorans sp. (strain BNC1) GN=serS PE=3 SV=1 32 429 7.0E-65
sp|Q6MRK1|SYS_BDEBA Serine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=serS PE=3 SV=1 25 429 7.0E-65
sp|Q2YCN3|SYS_NITMU Serine--tRNA ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=serS PE=3 SV=1 34 430 7.0E-65
sp|B9LIV1|SYS_CHLSY Serine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=serS PE=3 SV=1 15 429 8.0E-65
sp|A9WE34|SYS_CHLAA Serine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=serS PE=3 SV=1 15 429 8.0E-65
sp|A0R638|SYS_MYCS2 Serine--tRNA ligase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=serS PE=1 SV=1 14 427 8.0E-65
sp|A8AII9|SYS_CITK8 Serine--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=serS PE=3 SV=1 14 429 8.0E-65
sp|Q8YGS6|SYS_BRUME Serine--tRNA ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=serS PE=3 SV=2 14 429 8.0E-65
sp|C0RIL8|SYS_BRUMB Serine--tRNA ligase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=serS PE=3 SV=1 14 429 8.0E-65
sp|C0PXT0|SYS_SALPC Serine--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=serS PE=3 SV=1 14 429 8.0E-65
sp|Q0S9E8|SYS_RHOJR Serine--tRNA ligase OS=Rhodococcus jostii (strain RHA1) GN=serS PE=3 SV=1 14 427 8.0E-65
sp|P67563|SYS_SALTY Serine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=serS PE=3 SV=1 14 429 9.0E-65
sp|P67564|SYS_SALTI Serine--tRNA ligase OS=Salmonella typhi GN=serS PE=3 SV=1 14 429 9.0E-65
sp|B5BBR2|SYS_SALPK Serine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=serS PE=3 SV=1 14 429 9.0E-65
sp|A9N7X6|SYS_SALPB Serine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=serS PE=3 SV=1 14 429 9.0E-65
sp|Q5PGI6|SYS_SALPA Serine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=serS PE=3 SV=1 14 429 9.0E-65
sp|B4T128|SYS_SALNS Serine--tRNA ligase OS=Salmonella newport (strain SL254) GN=serS PE=3 SV=1 14 429 9.0E-65
sp|B5R8I1|SYS_SALG2 Serine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=serS PE=3 SV=1 14 429 9.0E-65
sp|B5QYP4|SYS_SALEP Serine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=serS PE=3 SV=1 14 429 9.0E-65
sp|B5FQ36|SYS_SALDC Serine--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=serS PE=3 SV=1 14 429 9.0E-65
sp|Q57R38|SYS_SALCH Serine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=serS PE=3 SV=1 14 429 9.0E-65
sp|B5F146|SYS_SALA4 Serine--tRNA ligase OS=Salmonella agona (strain SL483) GN=serS PE=3 SV=1 14 429 9.0E-65
sp|B0BYR8|SYS_ACAM1 Serine--tRNA ligase OS=Acaryochloris marina (strain MBIC 11017) GN=serS PE=3 SV=1 35 427 9.0E-65
sp|B9M3Q9|SYS_GEODF Serine--tRNA ligase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=serS PE=3 SV=1 12 430 9.0E-65
sp|P73201|SYS_SYNY3 Serine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=serS PE=3 SV=1 19 427 9.0E-65
sp|Q5WZ31|SYS_LEGPL Serine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=serS PE=3 SV=1 38 429 9.0E-65
sp|B3R376|SYS_CUPTR Serine--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=serS PE=3 SV=1 37 430 1.0E-64
sp|Q57DM2|SYS_BRUAB Serine--tRNA ligase OS=Brucella abortus biovar 1 (strain 9-941) GN=serS PE=3 SV=1 14 429 1.0E-64
sp|Q2YNM6|SYS_BRUA2 Serine--tRNA ligase OS=Brucella abortus (strain 2308) GN=serS PE=3 SV=1 14 429 1.0E-64
sp|B2S5B8|SYS_BRUA1 Serine--tRNA ligase OS=Brucella abortus (strain S19) GN=serS PE=3 SV=1 14 429 1.0E-64
sp|C4LGQ1|SYS_CORK4 Serine--tRNA ligase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=serS PE=3 SV=1 14 427 1.0E-64
sp|Q8G139|SYS_BRUSU Serine--tRNA ligase OS=Brucella suis biovar 1 (strain 1330) GN=serS PE=3 SV=1 14 429 1.0E-64
sp|B0CLL0|SYS_BRUSI Serine--tRNA ligase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=serS PE=3 SV=1 14 429 1.0E-64
sp|A9MAQ8|SYS_BRUC2 Serine--tRNA ligase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=serS PE=3 SV=1 14 429 1.0E-64
sp|Q2RTH5|SYS_RHORT Serine--tRNA ligase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=serS PE=3 SV=1 35 429 1.0E-64
sp|B5YEY8|SYS_DICT6 Serine--tRNA ligase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=serS PE=3 SV=1 14 427 1.0E-64
sp|Q6MUG5|SYS_MYCMS Serine--tRNA ligase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=serS PE=3 SV=1 32 435 2.0E-64
sp|Q32E12|SYS_SHIDS Serine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=serS PE=3 SV=1 14 429 2.0E-64
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0000166 nucleotide binding Yes
GO:0006139 nucleobase-containing compound metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0005488 binding No
GO:0006082 organic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043038 amino acid activation No
GO:0032555 purine ribonucleotide binding No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0043167 ion binding No
GO:0043039 tRNA aminoacylation No
GO:0043436 oxoacid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043168 anion binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0044281 small molecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:1901265 nucleoside phosphate binding No
GO:0006399 tRNA metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0034660 ncRNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032553 ribonucleotide binding No
GO:0019752 carboxylic acid metabolic process No
GO:0016874 ligase activity No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0030554 adenyl nucleotide binding No
GO:0006520 cellular amino acid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|944
MLDVNDFITDRGGDPEKIRDSQRRRNANIEIVDEVIALFEDHRQTNYSATQISSKINEVQKQIGIGKKAKENVDG
LLAQKQDLEKEKKLIAESAAKKDALLKSKLMTIGNIVHDTVPVSDDEDNNAIIRKWAPEGVSVEKRNVLSHHEVL
LRLDGYDPDRGVKVVGHRGYFLRQWGVFLNQALINYGLEFLSQRGYTPLQTPQFMHKDYMSKTAQLEAFDEELYK
VVDGEDKNDKYLIATSEQPISAFHADEWLIAKDLPIKYAGYSTCYRREAGSHGRDAWGIYRVHQFEKVEQFLLTD
PAKSWEAFDEMIATSEEFYKSLGLPYQVVAIVTGALNNAAAKKLDLEAWFPYQGEYKELVSCSNCTDYQSRALEI
RFGAKSQTDTKKKYVHCLNATLCATTRTLCCILENYQAEEGLNVPEPLRKYLPGSPGFLKYTKELPKESTSQKKS
Coding >Ophio5|944
ATGCTTGACGTGAACGACTTTATTACTGATCGCGGGGGTGACCCAGAAAAAATTCGAGACTCTCAGCGGCGTAGA
AATGCCAATATTGAGATCGTCGACGAGGTTATAGCCCTCTTCGAGGATCACCGCCAGACAAATTATAGCGCCACA
CAAATCAGCAGCAAGATCAACGAGGTCCAGAAGCAGATTGGAATCGGCAAAAAGGCTAAAGAAAATGTCGATGGC
TTGCTCGCGCAAAAGCAAGATCTCGAGAAGGAAAAGAAACTCATCGCGGAGTCTGCCGCAAAGAAGGATGCTCTC
CTTAAATCGAAACTTATGACAATTGGCAATATTGTTCATGACACCGTACCAGTCAGCGATGATGAAGACAATAAT
GCTATTATTCGAAAGTGGGCTCCAGAAGGTGTCTCGGTCGAGAAACGCAACGTGCTATCGCACCATGAAGTTCTC
CTTCGTCTAGATGGATATGACCCCGACCGCGGGGTCAAAGTTGTTGGTCATCGGGGCTACTTCCTTCGCCAATGG
GGTGTATTTCTCAACCAAGCCCTTATTAACTATGGCCTCGAATTTCTAAGCCAGCGCGGATACACCCCTTTACAG
ACACCGCAGTTCATGCATAAGGACTATATGAGCAAGACTGCACAGCTCGAAGCTTTTGATGAGGAGCTGTACAAA
GTCGTGGACGGCGAGGATAAGAACGACAAATATCTCATTGCTACCTCTGAGCAGCCTATCTCGGCTTTCCACGCC
GATGAGTGGCTTATTGCTAAGGATTTGCCCATCAAATATGCGGGCTACAGCACCTGCTACCGTCGTGAGGCTGGT
TCACATGGTCGAGATGCTTGGGGTATCTATCGCGTCCATCAGTTCGAGAAGGTCGAGCAATTTCTCCTGACGGAC
CCCGCCAAATCATGGGAGGCTTTTGACGAAATGATTGCCACTTCTGAGGAGTTCTACAAATCACTAGGACTACCA
TATCAGGTTGTTGCTATTGTGACAGGCGCGTTGAACAACGCAGCTGCCAAGAAACTGGATCTAGAAGCATGGTTT
CCGTATCAAGGGGAGTACAAGGAATTGGTTTCGTGTTCGAACTGCACCGACTACCAGTCACGAGCATTGGAGATT
CGTTTCGGCGCCAAGTCGCAGACAGATACGAAGAAGAAGTATGTCCACTGCCTGAATGCAACATTGTGCGCCACT
ACGAGGACGCTATGCTGCATTCTTGAAAACTACCAGGCTGAAGAGGGACTAAACGTGCCTGAACCTCTTCGTAAA
TATCTTCCTGGATCGCCCGGATTTTTGAAATACACAAAGGAGCTGCCGAAGGAGTCGACGTCGCAAAAAAAATCA
Transcript >Ophio5|944
ATGCTTGACGTGAACGACTTTATTACTGATCGCGGGGGTGACCCAGAAAAAATTCGAGACTCTCAGCGGCGTAGA
AATGCCAATATTGAGATCGTCGACGAGGTTATAGCCCTCTTCGAGGATCACCGCCAGACAAATTATAGCGCCACA
CAAATCAGCAGCAAGATCAACGAGGTCCAGAAGCAGATTGGAATCGGCAAAAAGGCTAAAGAAAATGTCGATGGC
TTGCTCGCGCAAAAGCAAGATCTCGAGAAGGAAAAGAAACTCATCGCGGAGTCTGCCGCAAAGAAGGATGCTCTC
CTTAAATCGAAACTTATGACAATTGGCAATATTGTTCATGACACCGTACCAGTCAGCGATGATGAAGACAATAAT
GCTATTATTCGAAAGTGGGCTCCAGAAGGTGTCTCGGTCGAGAAACGCAACGTGCTATCGCACCATGAAGTTCTC
CTTCGTCTAGATGGATATGACCCCGACCGCGGGGTCAAAGTTGTTGGTCATCGGGGCTACTTCCTTCGCCAATGG
GGTGTATTTCTCAACCAAGCCCTTATTAACTATGGCCTCGAATTTCTAAGCCAGCGCGGATACACCCCTTTACAG
ACACCGCAGTTCATGCATAAGGACTATATGAGCAAGACTGCACAGCTCGAAGCTTTTGATGAGGAGCTGTACAAA
GTCGTGGACGGCGAGGATAAGAACGACAAATATCTCATTGCTACCTCTGAGCAGCCTATCTCGGCTTTCCACGCC
GATGAGTGGCTTATTGCTAAGGATTTGCCCATCAAATATGCGGGCTACAGCACCTGCTACCGTCGTGAGGCTGGT
TCACATGGTCGAGATGCTTGGGGTATCTATCGCGTCCATCAGTTCGAGAAGGTCGAGCAATTTCTCCTGACGGAC
CCCGCCAAATCATGGGAGGCTTTTGACGAAATGATTGCCACTTCTGAGGAGTTCTACAAATCACTAGGACTACCA
TATCAGGTTGTTGCTATTGTGACAGGCGCGTTGAACAACGCAGCTGCCAAGAAACTGGATCTAGAAGCATGGTTT
CCGTATCAAGGGGAGTACAAGGAATTGGTTTCGTGTTCGAACTGCACCGACTACCAGTCACGAGCATTGGAGATT
CGTTTCGGCGCCAAGTCGCAGACAGATACGAAGAAGAAGTATGTCCACTGCCTGAATGCAACATTGTGCGCCACT
ACGAGGACGCTATGCTGCATTCTTGAAAACTACCAGGCTGAAGAGGGACTAAACGTGCCTGAACCTCTTCGTAAA
TATCTTCCTGGATCGCCCGGATTTTTGAAATACACAAAGGAGCTGCCGAAGGAGTCGACGTCGCAAAAAAAATCA
TGA
Gene >Ophio5|944
ATGCTTGACGTGAACGACTTTATTACTGATCGCGGGGGTGACCCAGAAAAAATTCGAGACTCTCAGCGGCGTAGA
AATGCCAATATTGAGATCGTCGACGAGGTTATAGCCCTCTTCGAGGATCACCGCCAGAGTATATTTTTTTTTTCG
TCTATGTCCCCAGCCTCCCATGGACTCCGACGCTAACGACGCTGGCACAGCAAATTATAGCGCCACACAAATCAG
CAGCAAGATCAACGAGGTCCAGAAGCAGATTGGAATCGGCAAAAAGGTTATCATCTTGTCACACCTTGTCAGCTC
ACTCCTTTTGACCTATTCCAGGCTAAAGAAAATGTCGATGGCTTGCTCGCGCAAAAGCAAGATCTCGAGAAGGAA
AAGAAACTCATCGCGGAGTCTGCCGCAAAGAAGGATGCTCTCCTTAAATCGAAACTTATGACAATTGGCAATATT
GTTCATGACACCGTACCAGTCAGCGATGATGAAGTAAATTCAAGGACCCTGCGGCTATTTCGCCGGCGCTTGTTA
TGTGACATGGACCGGTCCACTAATCATGCCTCTTAGGACAATAATGCTATTATTCGAAAGTGGGCTCCAGAAGGT
GTCTCGGTCGAGAAACGCAACGTGCTATCGCACCATGAAGTTCTCCTTCGTCTAGATGGATATGACCCCGACCGC
GGGGTCAAAGTTGTTGGTCATCGGGGCTACTTCCTTCGCCAATGGGGTGTATTTCTCAACCAAGCCCTTATTAAC
TATGGCCTCGAATTTCTAAGCCAGCGCGGATACACCCCTTTACAGACACCGCAGTTCATGCATAAGGACTATATG
AGCAAGACTGCACAGCTCGAAGCTTTTGATGAGGAGCTGTACAAAGTCGTGGACGGCGAGGATAAGAACGACAAA
TATCTCATTGCTACCTCTGAGCAGCCTATCTCGGCTTTCCACGCCGATGAGTGGCTTATTGCTAAGGATTTGCCC
ATCAAGTCAGTCTATTATGGCGTCGCAGATATTCGGTTTCATTCTGACTACCCTCTCTTAGATATGCGGGCTACA
GCACCTGCTACCGTCGTGAGGCTGGTTCACATGGTCGAGATGCTTGGGGTATCTATCGCGTCCATCAGTTCGAGA
AGGTACAATGCGTGTACCCTTCCTCTATTCGGCGCCTTGCGTCGACCTGGCCCTGGTTCAAATTGTGCATGATCA
TGGCAGTGCTAATCCATTAGTAGGTCGAGCAATTTCTCCTGACGGACCCCGCCAAATCATGGGAGGCTTTTGACG
AAATGATTGCCACTTCTGAGGAGTTCTACAAATCACTAGGACTACCATATCAGGTTGTTGCTATTGTGACAGGCG
CGTTGAACAACGCAGCTGCCAAGAAACTGGATCTAGAAGCATGGTTTCCGTATCAAGGGGAGTACAAGGAATTGG
TTTCGTGTTCGAACTGCACCGACTACCAGTCACGAGCATTGGAGATTCGTTTCGGCGCCAAGTCGCAGACAGATA
CGAAGAAGAAGTATGTCCACTGCCTGAATGCAACATTGTGCGCCACTACGAGGACGCTATGCTGCATTCTTGAAA
ACTACCAGGCTGAAGAGGTGAGAGCCGAATAATCCTTGAAGTTGCGTGTGGATCATGTTAAGAAGATTATAGGGA
CTAAACGTGCCTGAACCTCTTCGTAAATATCTTCCTGGATCGCCCGGATTTTTGAAATACACAAAGGAGCTGCCG
AAGGAGTCGACGTCGCAAAAAAAATCAGTAAGAAATATGAAAGGAAGCAGCTGAAGAGGGATAACGGGAAAGGAA
ATAGAGGCCTGACATCAGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail