Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|941
Gene name
Locationscaffold_1284:1418..1937
Strand-
Gene length (bp)519
Transcript length (bp)519
Coding sequence length (bp)516
Protein length (aa) 172

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5431 0.8466 0.5124 0.0471 0.0985 0.0177 0.2285 0.0561 0.0755 0.0003

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup369
Change Orthofinder run
Species Protein ID
Ophiocordyceps kimflemingae Ophio5|941 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10220
Ophiocordyceps subramaniannii Hirsu2|1656
Ophiocordyceps subramaniannii Hirsu2|552
Ophiocordyceps subramaniannii Hirsu2|7707
Ophiocordyceps subramaniannii Hirsu2|7736
Ophiocordyceps subramaniannii Hirsu2|8187
Ophiocordyceps subramaniannii Hirsu2|84
Ophiocordyceps subramaniannii Hirsu2|8425
Ophiocordyceps subramaniannii Hirsu2|8428

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|941
MSAAWMERWERLTREARTRRPRRDPVPADMLSPVNATKAALRPHEGLYKHESAALIQLRTGKIGLNEFLFQRGVP
EVPSPLCRCGEGRETVSHIFLSCPLIRIASEQLTPRPRTVLDLAISLGHRMRAGAFVRWFLTHRPIPHFVLATSL
AREWLNGDPDTTRSRPAHPTCE
Coding >Ophio5|941
ATGAGCGCAGCCTGGATGGAACGATGGGAGCGGCTCACTCGCGAAGCGAGGACGCGCCGCCCGCGACGCGACCCT
GTCCCTGCTGATATGCTCTCCCCAGTTAATGCGACGAAGGCCGCTCTACGCCCGCATGAGGGCTTATACAAGCAC
GAGAGCGCGGCACTCATCCAGCTTCGCACAGGCAAAATTGGGCTCAACGAATTCCTCTTCCAACGAGGCGTACCC
GAGGTGCCCTCGCCCCTTTGCCGCTGCGGTGAAGGGAGGGAGACGGTCTCTCATATCTTCCTTTCTTGTCCCCTC
ATACGCATCGCTTCCGAACAGCTGACCCCCCGCCCGCGCACCGTCCTCGATCTCGCTATCAGCCTCGGCCATAGA
ATGAGAGCCGGCGCCTTCGTCCGGTGGTTCCTCACTCATCGACCTATCCCCCACTTTGTACTCGCCACTTCCCTA
GCACGAGAATGGCTCAACGGCGACCCGGACACGACACGCAGCCGACCCGCTCACCCTACCTGCGAA
Transcript >Ophio5|941
ATGAGCGCAGCCTGGATGGAACGATGGGAGCGGCTCACTCGCGAAGCGAGGACGCGCCGCCCGCGACGCGACCCT
GTCCCTGCTGATATGCTCTCCCCAGTTAATGCGACGAAGGCCGCTCTACGCCCGCATGAGGGCTTATACAAGCAC
GAGAGCGCGGCACTCATCCAGCTTCGCACAGGCAAAATTGGGCTCAACGAATTCCTCTTCCAACGAGGCGTACCC
GAGGTGCCCTCGCCCCTTTGCCGCTGCGGTGAAGGGAGGGAGACGGTCTCTCATATCTTCCTTTCTTGTCCCCTC
ATACGCATCGCTTCCGAACAGCTGACCCCCCGCCCGCGCACCGTCCTCGATCTCGCTATCAGCCTCGGCCATAGA
ATGAGAGCCGGCGCCTTCGTCCGGTGGTTCCTCACTCATCGACCTATCCCCCACTTTGTACTCGCCACTTCCCTA
GCACGAGAATGGCTCAACGGCGACCCGGACACGACACGCAGCCGACCCGCTCACCCTACCTGCGAATGA
Gene >Ophio5|941
ATGAGCGCAGCCTGGATGGAACGATGGGAGCGGCTCACTCGCGAAGCGAGGACGCGCCGCCCGCGACGCGACCCT
GTCCCTGCTGATATGCTCTCCCCAGTTAATGCGACGAAGGCCGCTCTACGCCCGCATGAGGGCTTATACAAGCAC
GAGAGCGCGGCACTCATCCAGCTTCGCACAGGCAAAATTGGGCTCAACGAATTCCTCTTCCAACGAGGCGTACCC
GAGGTGCCCTCGCCCCTTTGCCGCTGCGGTGAAGGGAGGGAGACGGTCTCTCATATCTTCCTTTCTTGTCCCCTC
ATACGCATCGCTTCCGAACAGCTGACCCCCCGCCCGCGCACCGTCCTCGATCTCGCTATCAGCCTCGGCCATAGA
ATGAGAGCCGGCGCCTTCGTCCGGTGGTTCCTCACTCATCGACCTATCCCCCACTTTGTACTCGCCACTTCCCTA
GCACGAGAATGGCTCAACGGCGACCCGGACACGACACGCAGCCGACCCGCTCACCCTACCTGCGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail