Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|94
Gene name
Locationscaffold_10:65513..68045
Strand-
Gene length (bp)2532
Transcript length (bp)2424
Coding sequence length (bp)2421
Protein length (aa) 807

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12044 Metallopep Putative peptidase family 4.0E-162 159 577

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40483|YIK8_YEAST Putative zinc metalloproteinase YIL108W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL108W PE=1 SV=1 180 804 4.0E-126
sp|Q9US12|YK66_SCHPO Putative zinc metalloproteinase C607.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC607.06c PE=2 SV=1 160 806 2.0E-108

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.709 0.2688 0.3185 0.3535 0.1197 0.0465 0.1557 0.1519 0.2189 0.0966

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5709
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|121
Ophiocordyceps australis map64 (Brazil) OphauB2|3957
Ophiocordyceps camponoti-floridani Ophcf2|03226
Ophiocordyceps camponoti-rufipedis Ophun1|882
Ophiocordyceps kimflemingae Ophio5|94 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8857

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|94
MAPRFLSLRELRRRSKASFRTDNSTDGSSDGAVSQGTSPSSGSVTPPSIALQSDTALDMQVKNSPNPQGKPLPPR
PVLGSKLNGSRHSVSGMSGLGSPSLSGKNGLPLSKYAPRVHNVTENSWVRSRSHSPSPVLLASTPSRRLYRRGYR
VNIDTRAAQAYQKVLLVNGTIGEPGLPPIDGTIVVSKYDDSFPPVSWPVCESNFKVLLYLQPGPNKFRLDFSSPK
LANSTSSNPIHASFLTLHMLPTLSAPPLQLAILVGRDSPAVFDSVPARAEKEGNGLETAMNKFRMAAYLWQAFTA
EQMWRHKLGRRVFRFEEEWTVGTSNLRDRENGVMRSEARIHVIRSDKTVAELRDINKAQQNERGTDRDALFGIAA
DAVKKHFKPLPGQKNYVSVLLLDAHWDTNTKTITGHAALGGNSGDLQLAVFGSHCLQSYPSCFEEVVPAFTDCTP
TDTNCVANDCHDAGSSWEAANIGIGAHLHETGHLFGCPHQESGIMLRDYVVFNRTFVPREAYSTRTKSKGGLALQ
GDECGWHRLDALRFRSHPAFRLPSDAPPTPNDSVQAFPTEGGGVTVMAPTGISFVEIWGESDGVCGSWIEFPLDS
GPVQRQMSLHEQDLRSRLPEDKRKGRVKICIMSHGGGSLTIEDVKAFTSKASCVKMGGGRTAWRSQKVGESKMAG
SQDQDVVFTSATRQDRVMSRIIVYHGSALDGVEFVYDDDSTQLFGKRGGKKGGDVVEFDRRRGEYLSGFIVRAGL
WIDGLQVMTSLGRKSAMFGNAHGGSAHTLIPPRGYAICGVSGSCGSWVDGFSLLIKR
Coding >Ophio5|94
ATGGCTCCGAGGTTCCTGAGCTTGAGAGAGCTTCGCCGTCGCTCCAAGGCCAGCTTCCGCACCGACAACTCCACC
GACGGTTCCAGTGACGGCGCCGTGAGCCAGGGAACATCGCCTTCCAGCGGCTCCGTCACACCTCCTTCAATTGCC
CTGCAGTCTGATACGGCCCTCGACATGCAGGTCAAGAACAGCCCAAATCCGCAGGGCAAGCCCCTGCCACCCCGC
CCCGTACTGGGCTCCAAATTGAACGGCAGCAGACACAGCGTCTCTGGCATGTCCGGCCTTGGCTCTCCCTCTCTG
AGTGGCAAGAACGGCTTGCCCTTGTCCAAATATGCGCCGCGCGTTCACAACGTAACAGAAAACTCGTGGGTGCGT
TCAAGATCACATTCTCCGTCTCCTGTCTTGCTCGCATCTACCCCTTCCCGTCGTCTGTATCGGAGAGGATACCGA
GTTAATATTGACACACGGGCTGCGCAGGCATATCAAAAGGTACTCCTCGTCAACGGCACCATCGGAGAGCCTGGT
CTGCCTCCCATCGACGGTACCATTGTCGTCAGCAAGTATGACGACAGCTTCCCGCCAGTAAGCTGGCCGGTCTGC
GAATCCAACTTCAAGGTCCTGCTCTACTTGCAGCCCGGGCCAAACAAGTTTAGGCTCGACTTTTCGAGCCCCAAG
CTGGCCAACAGTACCTCTTCCAACCCTATTCACGCCTCCTTCCTGACCCTACACATGCTTCCCACCCTCAGCGCC
CCCCCGCTGCAGCTCGCCATACTCGTCGGGCGTGATTCACCCGCCGTTTTCGACTCCGTTCCCGCAAGGGCGGAA
AAGGAAGGCAATGGGCTCGAAACGGCCATGAACAAATTCCGCATGGCAGCCTACCTTTGGCAGGCCTTCACCGCC
GAGCAGATGTGGCGACACAAGCTGGGTCGTCGCGTCTTCAGGTTCGAGGAGGAGTGGACGGTCGGAACTTCGAAC
CTTCGCGACAGAGAGAACGGGGTGATGCGATCGGAGGCGAGGATACACGTCATCCGCTCCGACAAGACGGTTGCA
GAGTTGCGGGACATCAACAAGGCGCAGCAAAACGAGCGTGGCACTGACAGAGACGCCTTGTTCGGCATCGCAGCC
GACGCAGTCAAGAAGCACTTTAAGCCGCTCCCGGGGCAGAAGAACTACGTGTCGGTCCTCTTGCTCGACGCACAC
TGGGACACCAACACCAAGACCATCACGGGCCACGCGGCCCTCGGTGGCAATTCGGGCGATTTGCAGCTGGCCGTG
TTCGGCTCTCACTGCTTGCAGAGCTACCCCAGCTGCTTCGAAGAGGTGGTGCCCGCTTTCACCGACTGCACGCCC
ACGGACACGAACTGCGTGGCCAACGACTGCCACGACGCCGGCAGCTCGTGGGAAGCGGCCAATATCGGCATCGGC
GCCCACCTGCACGAGACGGGCCACCTGTTCGGCTGTCCACACCAGGAGTCCGGCATCATGCTGAGGGACTATGTC
GTCTTCAACCGCACCTTTGTCCCCCGCGAAGCCTACTCGACCCGGACCAAGTCCAAGGGCGGACTGGCCCTGCAG
GGCGACGAGTGCGGGTGGCACCGGCTGGACGCGCTCCGCTTCCGGAGCCACCCGGCCTTCCGGCTGCCCAGCGAC
GCTCCGCCCACGCCCAACGACAGTGTCCAAGCCTTCCCCACGGAAGGTGGCGGCGTGACGGTTATGGCGCCGACG
GGCATCTCGTTTGTGGAGATTTGGGGCGAGAGCGACGGCGTGTGCGGCTCGTGGATCGAGTTCCCGTTGGACAGC
GGTCCTGTGCAGCGACAGATGTCCCTCCACGAGCAAGACTTGCGGTCGAGGCTTCCCGAGGATAAGAGAAAGGGC
CGGGTCAAGATCTGCATCATGTCGCACGGTGGCGGATCTCTGACGATTGAGGACGTCAAGGCCTTCACGAGCAAG
GCGTCCTGCGTCAAGATGGGCGGGGGACGCACGGCTTGGAGGAGTCAGAAGGTGGGCGAGTCCAAGATGGCAGGC
AGCCAGGATCAGGACGTGGTCTTCACCAGCGCGACGAGGCAGGACAGGGTCATGTCTCGCATTATTGTCTACCAC
GGGTCGGCACTGGACGGTGTCGAGTTTGTCTACGACGACGACTCGACGCAGCTGTTTGGGAAGAGGGGGGGCAAG
AAGGGCGGCGACGTGGTGGAGTTTGACCGACGTCGCGGAGAGTACCTGAGCGGCTTCATCGTGCGGGCCGGCCTC
TGGATCGACGGTTTGCAGGTGATGACAAGCCTGGGACGCAAGTCGGCCATGTTTGGGAACGCGCACGGCGGATCT
GCGCATACACTGATTCCGCCGCGCGGATACGCCATCTGCGGCGTTTCGGGCTCTTGCGGCTCTTGGGTCGACGGA
TTCTCGCTCCTCATTAAGCGG
Transcript >Ophio5|94
ATGGCTCCGAGGTTCCTGAGCTTGAGAGAGCTTCGCCGTCGCTCCAAGGCCAGCTTCCGCACCGACAACTCCACC
GACGGTTCCAGTGACGGCGCCGTGAGCCAGGGAACATCGCCTTCCAGCGGCTCCGTCACACCTCCTTCAATTGCC
CTGCAGTCTGATACGGCCCTCGACATGCAGGTCAAGAACAGCCCAAATCCGCAGGGCAAGCCCCTGCCACCCCGC
CCCGTACTGGGCTCCAAATTGAACGGCAGCAGACACAGCGTCTCTGGCATGTCCGGCCTTGGCTCTCCCTCTCTG
AGTGGCAAGAACGGCTTGCCCTTGTCCAAATATGCGCCGCGCGTTCACAACGTAACAGAAAACTCGTGGGTGCGT
TCAAGATCACATTCTCCGTCTCCTGTCTTGCTCGCATCTACCCCTTCCCGTCGTCTGTATCGGAGAGGATACCGA
GTTAATATTGACACACGGGCTGCGCAGGCATATCAAAAGGTACTCCTCGTCAACGGCACCATCGGAGAGCCTGGT
CTGCCTCCCATCGACGGTACCATTGTCGTCAGCAAGTATGACGACAGCTTCCCGCCAGTAAGCTGGCCGGTCTGC
GAATCCAACTTCAAGGTCCTGCTCTACTTGCAGCCCGGGCCAAACAAGTTTAGGCTCGACTTTTCGAGCCCCAAG
CTGGCCAACAGTACCTCTTCCAACCCTATTCACGCCTCCTTCCTGACCCTACACATGCTTCCCACCCTCAGCGCC
CCCCCGCTGCAGCTCGCCATACTCGTCGGGCGTGATTCACCCGCCGTTTTCGACTCCGTTCCCGCAAGGGCGGAA
AAGGAAGGCAATGGGCTCGAAACGGCCATGAACAAATTCCGCATGGCAGCCTACCTTTGGCAGGCCTTCACCGCC
GAGCAGATGTGGCGACACAAGCTGGGTCGTCGCGTCTTCAGGTTCGAGGAGGAGTGGACGGTCGGAACTTCGAAC
CTTCGCGACAGAGAGAACGGGGTGATGCGATCGGAGGCGAGGATACACGTCATCCGCTCCGACAAGACGGTTGCA
GAGTTGCGGGACATCAACAAGGCGCAGCAAAACGAGCGTGGCACTGACAGAGACGCCTTGTTCGGCATCGCAGCC
GACGCAGTCAAGAAGCACTTTAAGCCGCTCCCGGGGCAGAAGAACTACGTGTCGGTCCTCTTGCTCGACGCACAC
TGGGACACCAACACCAAGACCATCACGGGCCACGCGGCCCTCGGTGGCAATTCGGGCGATTTGCAGCTGGCCGTG
TTCGGCTCTCACTGCTTGCAGAGCTACCCCAGCTGCTTCGAAGAGGTGGTGCCCGCTTTCACCGACTGCACGCCC
ACGGACACGAACTGCGTGGCCAACGACTGCCACGACGCCGGCAGCTCGTGGGAAGCGGCCAATATCGGCATCGGC
GCCCACCTGCACGAGACGGGCCACCTGTTCGGCTGTCCACACCAGGAGTCCGGCATCATGCTGAGGGACTATGTC
GTCTTCAACCGCACCTTTGTCCCCCGCGAAGCCTACTCGACCCGGACCAAGTCCAAGGGCGGACTGGCCCTGCAG
GGCGACGAGTGCGGGTGGCACCGGCTGGACGCGCTCCGCTTCCGGAGCCACCCGGCCTTCCGGCTGCCCAGCGAC
GCTCCGCCCACGCCCAACGACAGTGTCCAAGCCTTCCCCACGGAAGGTGGCGGCGTGACGGTTATGGCGCCGACG
GGCATCTCGTTTGTGGAGATTTGGGGCGAGAGCGACGGCGTGTGCGGCTCGTGGATCGAGTTCCCGTTGGACAGC
GGTCCTGTGCAGCGACAGATGTCCCTCCACGAGCAAGACTTGCGGTCGAGGCTTCCCGAGGATAAGAGAAAGGGC
CGGGTCAAGATCTGCATCATGTCGCACGGTGGCGGATCTCTGACGATTGAGGACGTCAAGGCCTTCACGAGCAAG
GCGTCCTGCGTCAAGATGGGCGGGGGACGCACGGCTTGGAGGAGTCAGAAGGTGGGCGAGTCCAAGATGGCAGGC
AGCCAGGATCAGGACGTGGTCTTCACCAGCGCGACGAGGCAGGACAGGGTCATGTCTCGCATTATTGTCTACCAC
GGGTCGGCACTGGACGGTGTCGAGTTTGTCTACGACGACGACTCGACGCAGCTGTTTGGGAAGAGGGGGGGCAAG
AAGGGCGGCGACGTGGTGGAGTTTGACCGACGTCGCGGAGAGTACCTGAGCGGCTTCATCGTGCGGGCCGGCCTC
TGGATCGACGGTTTGCAGGTGATGACAAGCCTGGGACGCAAGTCGGCCATGTTTGGGAACGCGCACGGCGGATCT
GCGCATACACTGATTCCGCCGCGCGGATACGCCATCTGCGGCGTTTCGGGCTCTTGCGGCTCTTGGGTCGACGGA
TTCTCGCTCCTCATTAAGCGGTGA
Gene >Ophio5|94
ATGGCTCCGAGGTTCCTGAGCTTGAGAGAGCTTCGCCGTCGCTCCAAGGCCAGCTTCCGCACCGACAACTCCACC
GACGGTTCCAGTGACGGCGCCGTGAGCCAGGGAACATCGCCTTCCAGCGGCTCCGTCACACCTCCTTCAATTGCC
CTGCAGTCTGATACGGCCCTCGACATGCAGGTCAAGAACAGCCCAAATCCGCAGGGCAAGCCCCTGCCACCCCGC
CCCGTACTGGGCTCCAAATTGAACGGCAGCAGACACAGCGTCTCTGGCATGTCCGGCCTTGGCTCTCCCTCTCTG
AGTGGCAAGAACGGCTTGCCCTTGTCCAAATATGCGCCGCGCGTTCACAACGTAACAGAAAACTCGTGGGTGCGT
TCAAGATCACATTCTCCGTCTCCTGTCTTGCTCGCATCTACCCCTTCCCGTCGTCTGTATCGGAGAGGATACCGA
GTTAATATTGACACACGGGCTGCGCAGGCATATCAAAAGGTACTCCTCGTCAACGGCACCATCGGAGAGCCTGGT
CTGCCTCCCATCGACGGTACCATTGTCGTCAGCAAGTATGACGACAGCTTCCCGCCAGTAAGCTGGCCGGTCTGC
GAATCCAACTTCAAGGTCCTGCTCTACTTGCAGCCCGGGCCAAACAAGTTTAGGCTCGACTTTTCGAGCCCCAAG
CTGGCCAACAGTACCTCTTCCAACCCTATTCACGCCTCCTTCCTGACCCTACACATGCTTCCCACCCTCAGCGCC
CCCCCGCTGCAGCTCGCCATACTCGTCGGGCGTGATTCACCCGCCGTTTTCGACTCCGTTCCCGCAAGGGCGGAA
AAGGAAGGCAATGGGCTCGAAACGGCCATGAACAAATTCCGCATGGCAGCCTACCTTTGGCAGGCCTTCACCGCC
GAGCAGATGTGGCGACACAAGCTGGGTCGTCGCGTCTTCAGGTTCGAGGAGGAGTGGACGGTCGGAACTTCGAAC
CTTCGCGACAGAGAGAACGGGGTGATGCGATCGGAGGCGAGGATACACGTCATCCGCTCCGACAAGACGGTTGCA
GAGTTGCGGGACATCAACAAGGCGCAGCAAAACGAGCGTGGCACTGACAGAGACGCCTTGTTCGGCATCGCAGCC
GACGCAGTCAAGAAGCACTTTAAGCCGCTCCCGGGGCAGAAGAACTACGTGTCGGTCCTCTTGCTCGACGCACAC
TGGGACACCAACACCAAGACCATCACGGGCCACGCGGCCCTCGGTGGCAATTCGGGCGATTTGCAGCTGGCCGTG
TTCGGCTCTCACTGCTTGCAGAGCTACCCCAGCTGCTTCGAAGAGGTGGTGCCCGCTTTCACCGACTGCACGCCC
ACGGACACGAACTGCGTGGCCAACGACTGCCACGACGCCGGCAGCTCGTGGGAAGCGGCCAATATCGGCATCGGC
GCCCACCTGCACGAGACGGGCCACCTGTTCGGCTGTCCACACCAGGAGTCCGGCATCATGCTGAGGGACTATGTC
GTCTTCAACCGCACCTTTGTCCCCCGCGAAGCCTACTCGACCCGGACCAAGTCCAAGGGCGGACTGGCCCTGCAG
GGCGACGAGTGCGGGTGGCACCGGCTGGACGCGCTCCGCTTCCGGAGCCACCCGGCCTTCCGGCTGCCCAGCGAC
GCTCCGCCCACGCCCAACGACAGTGTCCAAGCCTTCCCCACGGAAGGTGGCGGCGTGACGGTTATGGCGCCGACG
GGCATCTCGTTTGTGGAGATTTGGGGCGAGAGCGACGGCGTGTGCGGCTCGTGGATCGAGTTCCCGTTGGACAGC
GGTCCTGTGCAGCGACAGATGTCCCTCCACGAGCAAGACTTGCGGTCGAGGCTTCCCGAGGATAAGAGAAAGGGC
CGGGTCAAGATCTGCATCATGTCGCACGGTGGCGGATCTCTGACGATTGAGGACGTCAAGGCCTTCACGAGCAAG
GCGTCCTGCGTCAAGATGGGCGGGGGACGCACGGCTTGGAGGAGTCAGAAGGTGGGCGAGTCCAAGATGGCAGGC
AGCCAGGATCAGGACGTGGTCTTCACCAGCGCGACGAGGCAGGACAGGGTCATGTCTCGCATTATTGTCTACCAC
GGGTCGGCACTGGACGGTGTCGAGTTTGTCTACGACGACGACTCGACGCAGCTGTTTGGGAAGAGGGGGGGCAAG
AAGGGCGGCGACGTGGTGGAGTTTGGTGAGTGCCTTGGACACATCTTGGACAGAGCGAGACGAGGGCTGACGAGA
GCAGACCGACGTCGCGGAGAGTACCTGAGCGGCTTCATCGTGCGGGCCGGCCTCTGGATCGACGGTTTGCAGGTG
ATGACAAGCCTGGGACGCAAGTCGGCCATGTTTGGGAACGCGCACGGCGGATCTGCGTAAGTGGTCCGAAAATGA
ACGGCGGAAAGGGCATTGCTGACAGCTGGCTGCAGGCATACACTGATTCCGCCGCGCGGATACGCCATCTGCGGC
GTTTCGGGCTCTTGCGGCTCTTGGGTCGACGGATTCTCGCTCCTCATTAAGCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail