Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|93
Gene name
Locationscaffold_10:63618..64618
Strand-
Gene length (bp)1000
Transcript length (bp)741
Coding sequence length (bp)738
Protein length (aa) 246

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase 1.9E-25 49 205

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94584|PSS_SCHPO CDP-diacylglycerol--serine O-phosphatidyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pps1 PE=1 SV=2 19 245 7.0E-86
sp|P08456|PSS_YEAST CDP-diacylglycerol--serine O-phosphatidyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHO1 PE=1 SV=3 27 246 2.0E-83
sp|P39823|PSS_BACSU CDP-diacylglycerol--serine O-phosphatidyltransferase OS=Bacillus subtilis (strain 168) GN=pssA PE=3 SV=1 50 187 3.0E-18
sp|Q48269|PSS_HELPY CDP-diacylglycerol--serine O-phosphatidyltransferase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=pssA PE=3 SV=2 53 187 1.0E-14
sp|Q9ZM68|PSS_HELPJ CDP-diacylglycerol--serine O-phosphatidyltransferase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=pssA PE=3 SV=1 53 187 7.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94584|PSS_SCHPO CDP-diacylglycerol--serine O-phosphatidyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pps1 PE=1 SV=2 19 245 7.0E-86
sp|P08456|PSS_YEAST CDP-diacylglycerol--serine O-phosphatidyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHO1 PE=1 SV=3 27 246 2.0E-83
sp|P39823|PSS_BACSU CDP-diacylglycerol--serine O-phosphatidyltransferase OS=Bacillus subtilis (strain 168) GN=pssA PE=3 SV=1 50 187 3.0E-18
sp|Q48269|PSS_HELPY CDP-diacylglycerol--serine O-phosphatidyltransferase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=pssA PE=3 SV=2 53 187 1.0E-14
sp|Q9ZM68|PSS_HELPJ CDP-diacylglycerol--serine O-phosphatidyltransferase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=pssA PE=3 SV=1 53 187 7.0E-14
sp|O27106|ARSS_METTH Archaetidylserine synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1027 PE=1 SV=1 49 189 7.0E-14
sp|Q58609|PSS_METJA CDP-diacylglycerol--serine O-phosphatidyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pssA PE=3 SV=1 43 187 3.0E-13
sp|Q9ZBM2|PSS_MYCLE CDP-diacylglycerol--serine O-phosphatidyltransferase OS=Mycobacterium leprae (strain TN) GN=pssA PE=3 SV=1 98 203 1.0E-11
sp|P9WPG1|PSS_MYCTU CDP-diacylglycerol--serine O-phosphatidyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pssA PE=3 SV=1 98 207 1.0E-10
sp|P9WPG0|PSS_MYCTO CDP-diacylglycerol--serine O-phosphatidyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pssA PE=3 SV=1 98 188 5.0E-10
sp|P59949|PSS_MYCBO CDP-diacylglycerol--serine O-phosphatidyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pssA PE=3 SV=1 98 188 5.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016780 phosphotransferase activity, for other substituted phosphate groups Yes
GO:0016020 membrane Yes
GO:0008654 phospholipid biosynthetic process Yes
GO:0006793 phosphorus metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0008150 biological_process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006644 phospholipid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0009058 biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006629 lipid metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0090407 organophosphate biosynthetic process No
GO:0044249 cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.5

Transmembrane Domains

Domain # Start End Length
1 49 71 22
2 84 101 17
3 121 140 19
4 147 169 22
5 213 235 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|93
MGSGSQQQQEQQQEQQEQQQEQQQQPAMDKQKMLLSSDVVGHFSLVRAMHLADLITLMNGFCGVMSIFSSLRYTL
GSPHDVDKAWLALALLPFGLVFDFLDGKVARWRNKSSLMGQELDSLADLISFGVAPAMVAFTLGLRSPIDTLGLT
FFVLCGLTRLARFNVTVAALPKDASGKSAYFEGTPIPTSLAVDALMAYWLHKGWILDDLPLGVYFPASILEFHPA
LVIFILHGCLMTSKTIRIPKP
Coding >Ophio5|93
ATGGGCTCGGGATCGCAGCAGCAGCAGGAGCAGCAGCAGGAGCAGCAGGAGCAGCAGCAGGAGCAGCAACAACAG
CCTGCTATGGATAAGCAGAAGATGTTGTTGTCGTCGGATGTGGTTGGGCATTTTTCGCTCGTGAGGGCGATGCAT
CTCGCCGACCTCATTACGCTCATGAACGGCTTCTGCGGCGTCATGTCCATCTTTTCTTCTCTTCGCTACACGCTA
GGCTCTCCGCACGATGTCGACAAGGCTTGGTTGGCGCTTGCTCTCTTGCCTTTTGGCTTGGTCTTTGACTTTTTG
GATGGGAAGGTGGCGCGCTGGCGGAATAAGAGCAGCCTCATGGGACAGGAGCTCGACTCGCTCGCCGACCTGATC
TCCTTCGGCGTTGCCCCCGCAATGGTCGCCTTCACCCTCGGCCTCCGCTCCCCGATCGACACGCTTGGCCTTACC
TTCTTCGTCCTCTGCGGCCTCACCCGCCTCGCCCGATTCAACGTCACCGTCGCCGCCCTGCCCAAGGACGCGTCC
GGCAAGAGCGCCTACTTCGAGGGCACTCCCATCCCCACGTCGCTCGCCGTTGACGCCCTCATGGCCTACTGGCTG
CACAAGGGCTGGATTCTCGACGACCTGCCTCTCGGCGTCTACTTTCCCGCTTCCATCTTGGAGTTTCATCCCGCC
CTCGTCATCTTCATCCTACACGGCTGCCTCATGACGAGCAAGACTATTCGCATACCCAAGCCT
Transcript >Ophio5|93
ATGGGCTCGGGATCGCAGCAGCAGCAGGAGCAGCAGCAGGAGCAGCAGGAGCAGCAGCAGGAGCAGCAACAACAG
CCTGCTATGGATAAGCAGAAGATGTTGTTGTCGTCGGATGTGGTTGGGCATTTTTCGCTCGTGAGGGCGATGCAT
CTCGCCGACCTCATTACGCTCATGAACGGCTTCTGCGGCGTCATGTCCATCTTTTCTTCTCTTCGCTACACGCTA
GGCTCTCCGCACGATGTCGACAAGGCTTGGTTGGCGCTTGCTCTCTTGCCTTTTGGCTTGGTCTTTGACTTTTTG
GATGGGAAGGTGGCGCGCTGGCGGAATAAGAGCAGCCTCATGGGACAGGAGCTCGACTCGCTCGCCGACCTGATC
TCCTTCGGCGTTGCCCCCGCAATGGTCGCCTTCACCCTCGGCCTCCGCTCCCCGATCGACACGCTTGGCCTTACC
TTCTTCGTCCTCTGCGGCCTCACCCGCCTCGCCCGATTCAACGTCACCGTCGCCGCCCTGCCCAAGGACGCGTCC
GGCAAGAGCGCCTACTTCGAGGGCACTCCCATCCCCACGTCGCTCGCCGTTGACGCCCTCATGGCCTACTGGCTG
CACAAGGGCTGGATTCTCGACGACCTGCCTCTCGGCGTCTACTTTCCCGCTTCCATCTTGGAGTTTCATCCCGCC
CTCGTCATCTTCATCCTACACGGCTGCCTCATGACGAGCAAGACTATTCGCATACCCAAGCCTTGA
Gene >Ophio5|93
ATGGGCTCGGGATCGCAGCAGCAGCAGGAGCAGCAGCAGGAGCAGCAGGAGCAGCAGCAGGAGCAGCAACAACAG
CCTGGTAAGCTCGCGGCTCGCCAACAGAGGTGATGGTGTTGATGATGGGAAGAGGAGAGAAACTGACGCGACGGC
TAGCTATGGATAAGCAGAAGATGTTGTTGTCGTCGGATGTGGTTGGGCATTTTTCGCTCGTGAGGGCGATGCATC
TCGCCGACCTCATTACGCTCATGAACGGTTCGCGTCTCCCCCTTCCTCTATAGACTGGCTGTTTGTGTGTGTCTC
GTCGTCGCTGATGACCTTGCTTTTTTTTTTTTTCCCCTCTCTTTTTCCTTTCGTCTTTAGGCTTCTGCGGCGTCA
TGTCCATCTTTTCTTCTCTTCGCTACACGCTAGGCTCTCCGCACGATGTCGACAAGGCTTGGTTGGCGCTTGCTC
TCTTGCCTTTTGGCTTGGTCTTTGACTTTTTGGATGGGAAGGTGGCGCGCTGGCGGAATAAGAGCAGCCTCATGG
GACAGGAGCTCGACTCGCTCGCCGACCTGGTGCGTCTTTCTTTCTTCTCTAACCCCCCTTCTTTTCCTTCATCTT
GTCATGTCTCTTGGAGCTGATGATTTTCAAGATCTCCTTCGGCGTTGCCCCCGCAATGGTCGCCTTCACCCTCGG
CCTCCGCTCCCCGATCGACACGCTTGGCCTTACCTTCTTCGTCCTCTGCGGCCTCACCCGCCTCGCCCGATTCAA
CGTCACCGTCGCCGCCCTGCCCAAGGACGCGTCCGGCAAGAGCGCCTACTTCGAGGGCACTCCCATCCCCACGTC
GCTCGCCGTTGACGCCCTCATGGCCTACTGGCTGCACAAGGGCTGGATTCTCGACGACCTGCCTCTCGGCGTCTA
CTTTCCCGCTTCCATCTTGGAGTTTCATCCCGCCCTCGTCATCTTCATCCTACACGGCTGCCTCATGACGAGCAA
GACTATTCGCATACCCAAGCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail