Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|929
Gene name
Locationscaffold_128:19465..21915
Strand+
Gene length (bp)2450
Transcript length (bp)2085
Coding sequence length (bp)2082
Protein length (aa) 694

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17168 DUF5127 Domain of unknown function (DUF5127) 4.5E-76 107 338
PF16335 DUF4965 Domain of unknown function (DUF4965) 1.7E-72 346 514
PF08760 DUF1793 Domain of unknown function (DUF1793) 6.5E-61 520 691

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q2U4L7|GTAA_ASPOR Glutaminase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gtaA PE=1 SV=2 1 692 0.0E+00
sp|D4AMT2|GTAA_ARTBC Probable glutaminase ARB_05535/05536 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05535/05536 PE=1 SV=2 30 693 5.0E-117

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|929
MKFVKLAAAAVLTVLGREAEADSQFYPARPPAAPLAVRSPFLNVWLNGQPNGGKDGYLPGQWPRFWTEAVQGWQG
YIKVDGKNFNWMGDAPVKAPNVDQVSLEYTSTRTTFIMNVDGKVQMKINFLSPVYYDDMRRQSITSSYLEVSVKS
LDGRPHNVQIYCDVSGEWASGDTNAVIQWESGTRDNVRYHKFHRKDQQAFKDINEIASWGNWYWATGDQDGTSTE
IGEDNYVRNMFMNNGRLNNQVDPKHRAIRDHWPVFAFARDLKNVAGDWKSTLFTIGYTQDDAINFQGKEGQPRAV
PSLWRSYHHEDQLVSIFYKDYSYAVQHSQRLDDRVSRDSQAVAGTAGKNYATITSLAVRQVFGALGFTGTQQQPL
IFLKEISSNSDIQTVDVIFPAFPILLYLNPDLLRYMLDPLLENGRTHYPNNYAQHDLGRYPVALGHPKGDDEQMP
LEECGNMVIMMLAYAQRKRDNGYLAANWDLLDKWAQYLVQDAKIPANQLSTDDFAGHLANQTNLALKGIIALEAM
SKIAGATGHPAQQKRYGDTARDYLKFWQQHAINTNANPRHTMLQYDSPNSYGLLYNIYSDKVLNLNFIPQSIYDM
QSDFYLSVQKRFGVILDTRGTLTKLDWEMFSAAVAKEQTRNMFINKIAEWIGQTPTWRAFTDLYDTGSGGYPPGL
QFTARPVQGGVFSLLALRA
Coding >Ophio5|929
ATGAAGTTCGTCAAGCTCGCCGCCGCCGCCGTCCTCACCGTCCTCGGGCGTGAGGCCGAGGCCGATTCTCAGTTC
TACCCTGCTCGCCCTCCGGCTGCGCCACTGGCTGTTCGCTCTCCCTTCCTCAACGTCTGGCTGAACGGTCAGCCC
AACGGTGGCAAGGATGGCTACCTGCCTGGCCAGTGGCCTCGCTTCTGGACCGAAGCCGTTCAGGGATGGCAAGGT
TACATCAAGGTCGACGGCAAGAACTTCAACTGGATGGGAGATGCCCCTGTCAAGGCCCCCAATGTCGATCAGGTT
TCGCTCGAGTACACGTCTACCAGGACCACTTTTATCATGAACGTCGATGGCAAGGTTCAGATGAAAATTAACTTT
CTGTCCCCCGTCTACTATGACGATATGCGACGCCAGTCCATCACATCGTCCTACCTTGAAGTTTCGGTCAAGTCT
CTCGACGGTCGTCCCCACAACGTACAGATCTACTGCGACGTCTCTGGCGAATGGGCTTCTGGCGATACCAATGCC
GTCATCCAGTGGGAGAGCGGCACCAGGGACAATGTCCGCTACCACAAATTCCACCGCAAGGACCAGCAGGCCTTC
AAGGACATCAACGAGATCGCCTCGTGGGGCAACTGGTACTGGGCAACGGGTGATCAGGACGGCACGTCTACCGAG
ATCGGCGAAGACAACTACGTCCGTAATATGTTCATGAATAATGGCCGCCTCAACAACCAGGTTGACCCCAAGCAC
CGCGCCATACGTGATCATTGGCCCGTCTTTGCCTTCGCCCGCGACCTCAAGAATGTTGCCGGCGACTGGAAGAGC
ACTCTTTTCACAATCGGTTACACGCAGGATGACGCCATCAACTTCCAGGGCAAGGAGGGCCAGCCTAGGGCTGTG
CCGTCGCTCTGGAGGAGCTATCACCACGAGGACCAGCTCGTCAGCATCTTCTACAAGGATTACAGCTACGCGGTC
CAGCACTCGCAGCGGCTCGATGATCGCGTCAGCCGGGACTCGCAGGCCGTCGCGGGCACTGCCGGTAAGAACTAC
GCCACCATCACCAGTCTGGCCGTCCGCCAGGTCTTTGGCGCCCTCGGCTTCACCGGTACTCAACAGCAGCCACTT
ATCTTCCTCAAGGAGATCAGCTCCAACAGCGACATCCAGACGGTCGACGTCATCTTCCCGGCCTTCCCCATCCTG
CTGTACCTGAACCCCGACCTCCTGCGGTACATGCTGGACCCGCTGCTGGAGAATGGCCGGACGCACTATCCCAAC
AACTACGCCCAGCACGACCTCGGCCGCTACCCCGTGGCACTCGGTCATCCCAAGGGAGACGATGAGCAGATGCCC
CTGGAGGAGTGTGGCAACATGGTCATCATGATGCTGGCCTACGCACAGCGGAAGCGCGACAACGGCTACCTGGCG
GCCAACTGGGACCTGCTGGATAAGTGGGCGCAGTACCTAGTTCAGGACGCCAAGATCCCGGCCAACCAGCTGTCG
ACGGACGACTTTGCCGGCCATCTTGCCAACCAGACGAACCTGGCCCTCAAGGGCATCATCGCTCTGGAGGCCATG
TCCAAGATTGCCGGAGCAACGGGCCACCCGGCGCAGCAAAAAAGATACGGCGATACGGCGCGAGACTATCTCAAG
TTTTGGCAACAGCACGCCATCAACACGAATGCCAACCCAAGGCACACGATGCTGCAATACGACAGCCCCAACTCT
TATGGGCTGCTGTACAACATCTACTCGGACAAGGTGCTTAACCTCAATTTCATCCCGCAGTCGATATACGACATG
CAGAGCGACTTTTACCTCAGCGTTCAGAAGCGGTTCGGCGTCATCCTCGACACGCGCGGCACGCTGACAAAACTC
GACTGGGAGATGTTCTCGGCGGCCGTGGCCAAGGAGCAGACGCGCAACATGTTCATCAACAAGATTGCCGAGTGG
ATCGGACAAACGCCGACGTGGCGGGCATTTACCGACCTGTACGACACGGGGTCCGGCGGGTACCCACCCGGCTTG
CAGTTTACGGCCCGTCCGGTCCAGGGCGGCGTCTTTTCCCTGCTGGCGCTGCGGGCC
Transcript >Ophio5|929
ATGAAGTTCGTCAAGCTCGCCGCCGCCGCCGTCCTCACCGTCCTCGGGCGTGAGGCCGAGGCCGATTCTCAGTTC
TACCCTGCTCGCCCTCCGGCTGCGCCACTGGCTGTTCGCTCTCCCTTCCTCAACGTCTGGCTGAACGGTCAGCCC
AACGGTGGCAAGGATGGCTACCTGCCTGGCCAGTGGCCTCGCTTCTGGACCGAAGCCGTTCAGGGATGGCAAGGT
TACATCAAGGTCGACGGCAAGAACTTCAACTGGATGGGAGATGCCCCTGTCAAGGCCCCCAATGTCGATCAGGTT
TCGCTCGAGTACACGTCTACCAGGACCACTTTTATCATGAACGTCGATGGCAAGGTTCAGATGAAAATTAACTTT
CTGTCCCCCGTCTACTATGACGATATGCGACGCCAGTCCATCACATCGTCCTACCTTGAAGTTTCGGTCAAGTCT
CTCGACGGTCGTCCCCACAACGTACAGATCTACTGCGACGTCTCTGGCGAATGGGCTTCTGGCGATACCAATGCC
GTCATCCAGTGGGAGAGCGGCACCAGGGACAATGTCCGCTACCACAAATTCCACCGCAAGGACCAGCAGGCCTTC
AAGGACATCAACGAGATCGCCTCGTGGGGCAACTGGTACTGGGCAACGGGTGATCAGGACGGCACGTCTACCGAG
ATCGGCGAAGACAACTACGTCCGTAATATGTTCATGAATAATGGCCGCCTCAACAACCAGGTTGACCCCAAGCAC
CGCGCCATACGTGATCATTGGCCCGTCTTTGCCTTCGCCCGCGACCTCAAGAATGTTGCCGGCGACTGGAAGAGC
ACTCTTTTCACAATCGGTTACACGCAGGATGACGCCATCAACTTCCAGGGCAAGGAGGGCCAGCCTAGGGCTGTG
CCGTCGCTCTGGAGGAGCTATCACCACGAGGACCAGCTCGTCAGCATCTTCTACAAGGATTACAGCTACGCGGTC
CAGCACTCGCAGCGGCTCGATGATCGCGTCAGCCGGGACTCGCAGGCCGTCGCGGGCACTGCCGGTAAGAACTAC
GCCACCATCACCAGTCTGGCCGTCCGCCAGGTCTTTGGCGCCCTCGGCTTCACCGGTACTCAACAGCAGCCACTT
ATCTTCCTCAAGGAGATCAGCTCCAACAGCGACATCCAGACGGTCGACGTCATCTTCCCGGCCTTCCCCATCCTG
CTGTACCTGAACCCCGACCTCCTGCGGTACATGCTGGACCCGCTGCTGGAGAATGGCCGGACGCACTATCCCAAC
AACTACGCCCAGCACGACCTCGGCCGCTACCCCGTGGCACTCGGTCATCCCAAGGGAGACGATGAGCAGATGCCC
CTGGAGGAGTGTGGCAACATGGTCATCATGATGCTGGCCTACGCACAGCGGAAGCGCGACAACGGCTACCTGGCG
GCCAACTGGGACCTGCTGGATAAGTGGGCGCAGTACCTAGTTCAGGACGCCAAGATCCCGGCCAACCAGCTGTCG
ACGGACGACTTTGCCGGCCATCTTGCCAACCAGACGAACCTGGCCCTCAAGGGCATCATCGCTCTGGAGGCCATG
TCCAAGATTGCCGGAGCAACGGGCCACCCGGCGCAGCAAAAAAGATACGGCGATACGGCGCGAGACTATCTCAAG
TTTTGGCAACAGCACGCCATCAACACGAATGCCAACCCAAGGCACACGATGCTGCAATACGACAGCCCCAACTCT
TATGGGCTGCTGTACAACATCTACTCGGACAAGGTGCTTAACCTCAATTTCATCCCGCAGTCGATATACGACATG
CAGAGCGACTTTTACCTCAGCGTTCAGAAGCGGTTCGGCGTCATCCTCGACACGCGCGGCACGCTGACAAAACTC
GACTGGGAGATGTTCTCGGCGGCCGTGGCCAAGGAGCAGACGCGCAACATGTTCATCAACAAGATTGCCGAGTGG
ATCGGACAAACGCCGACGTGGCGGGCATTTACCGACCTGTACGACACGGGGTCCGGCGGGTACCCACCCGGCTTG
CAGTTTACGGCCCGTCCGGTCCAGGGCGGCGTCTTTTCCCTGCTGGCGCTGCGGGCCTGA
Gene >Ophio5|929
ATGAAGTTCGTCAAGCTCGCCGCCGCCGCCGTCCTCACCGTCCTCGGGCGTGAGGCCGAGGCCGATTCTCAGTTC
TACCCTGCTCGCCCTCCGGCTGCGCCACTGGCTGTTCGCTCTCCCTTCCTCAACGTCTGGCTGAACGGTCAGCCC
AACGGTGGCAAGGATGGCTACCTGCCTGGCCAGTGGCCTCGCTTCTGGACGTAGGTTTGATCCTCTCGCCCTTTG
CCGGCACGCTTCCCCGTTGCTGACGCCTTGACAGCGAAGCCGTTCAGGGATGGCAAGGTTACATCAAGGTCGACG
GCAAGAACTTCAACTGGATGGGAGATGCCCCTGTCAAGGCCCCCAATGTCGATCAGGTTTCGCTCGAGTACACGT
CTACCAGGACCACTTTTATCATGAACGTCGATGGCAAGGTTCAGATGAAAATTAACTTTCTGTCCCCCGTCTACT
ATGACGATATGCGACGCCAGTCCATCACATCGTCCTACCTTGAAGTTTCGGTCAAGTCTCTCGACGGTCGTCCCC
ACAACGTACAGATCTACTGCGACGTCTCTGGCGGTAAGTTCTTTTCTTTTTCGTAGCGTTTCGGCCCCCGGCTGA
ACAAGCTTAGAATGGGCTTCTGGCGATACCAATGCCGTCATCCAGTGGGAGAGCGGCACCAGGGACAATGTCCGC
TACCACAAATTCCACCGCAAGGACCAGCAGGCCTTCAAGGACATCAACGAGATCGCCTCGTGGGGCAACTGGTAC
TGGGCAACGGGTGATCAGGTACGTTCTCTGTCGGCCCCAGTCTGTGTGCCGTGCCGCTGATCGTCGGCCGGGAAT
AGGACGGCACGTCTACCGAGATCGGCGAAGACAACTACGTCCGTAATATGTTCATGAATAATGGCCGCCTCAACA
ACCAGGTTGACCCCAAGCACCGCGCCATACGTGATCATTGGTGAGCGAGCATAAAGCGGCCCCGAAACTATCATG
GCCGTCGCCGCTGACCGACCTCTAGGCCCGTCTTTGCCTTCGCCCGCGACCTCAAGAATGTTGCCGGCGACTGGA
AGAGCACTCTTTTCACAATCGGTTACACGCAGGATGACGCCATCAACTTCCAGGGCAAGGAGGGCCAGCCTAGGG
CTGTGCCGTCGCTCTGGAGGAGCTATCACCACGAGGACCAGCTCGTCAGCATCTTCTACAAGGATTACAGCTACG
CGGTCCAGCACTCGCAGCGGCTCGATGATCGCGTCAGCCGGGACTCGCAGGCCGTCGCGGGCACTGCCGGTAAGA
ACTACGCCACCATCACCAGTCTGGCCGTCCGCCAGGTCTTTGGCGCCCTCGGCTTCACCGGTACTCAACAGCAGC
CACTTATCTTCCTCAAGGAGATCAGCTCCAACAGCGACATCCAGACGGTCGACGTCATCTTCCCGGCCTTCCCCA
TCCTGCTGTACCTGAACCCCGACCTCCTGCGGTACATGCTGGACCCGCTGCTGGAGAATGGCCGGACGCACTATC
CCAACAACTACGCCCAGCACGACCTCGGCCGCTACCCCGTGGCACTCGGTCATCCCAAGGGAGACGATGAGCAGA
TGCCCCTGGAGGAGTGTGGCAACATGGTCATCATGATGCTGGCCTACGCACAGCGGAAGCGCGACAACGGCTACC
TGGCGGCCAACTGGGACCTGCTGGATAAGTGGGCGCAGTACCTAGTTCAGGACGCCAAGATCCCGGCCAACCAGC
TGTCGACGGACGACTTTGCCGGCCATCTTGCGTGAGTTTGACGACGGCTTATATCTGAGTGTGTGAGACTGACGG
TGGCGCAATAGCAACCAGACGAACCTGGCCCTCAAGGGCATCATCGCTCTGGAGGCCATGTCCAAGATTGCCGGA
GCAACGGGCCACCCGGCGCAGCAAAAAAGATACGGCGATACGGCGCGAGACTATCTCAAGTTTTGGCAACAGCAC
GCCATCAACACGAATGCCAACCCAAGGCACACGATGCTGCAATACGACAGCCCCAACTCTTATGGTGGGTGCCCC
CATTACCCTTCCGTCCCCTCCCCCCAACCCCCTCCAAAAAAACCCCCCGGAGACTGACTCGCTCTGCAGGGCTGC
TGTACAACATCTACTCGGACAAGGTGCTTAACCTCAATTTCATCCCGCAGTCGATATACGACATGCAGAGCGACT
TTTACCTCAGCGTTCAGAAGCGGTTCGGCGTCATCCTCGACACGCGCGGCACGCTGACAAAACTCGACTGGGAGA
TGTTCTCGGCGGCCGTGGCCAAGGAGCAGACGCGCAACATGTTCATCAACAAGATTGCCGAGTGGATCGGACAAA
CGCCGACGTGGCGGGCATTTACCGACCTGTACGACACGGGGTCCGGCGGGTACCCACCCGGCTTGCAGTTTACGG
CCCGTCCGGTCCAGGGCGGCGTCTTTTCCCTGCTGGCGCTGCGGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail