Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|928
Gene name
Locationscaffold_128:13889..15858
Strand+
Gene length (bp)1969
Transcript length (bp)1680
Coding sequence length (bp)1677
Protein length (aa) 559

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.5E-31 67 455
PF00083 Sugar_tr Sugar (and other) transporter 1.2E-05 135 481

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 51 525 1.0E-126
sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.15c PE=3 SV=1 14 503 3.0E-118
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 33 372 8.0E-34
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 47 320 1.0E-31
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 33 524 5.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 51 525 1.0E-126
sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.15c PE=3 SV=1 14 503 3.0E-118
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 33 372 8.0E-34
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 47 320 1.0E-31
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 33 524 5.0E-28
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 52 252 3.0E-25
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 57 375 2.0E-23
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 14 418 6.0E-19
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 50 399 1.0E-18
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 5 449 1.0E-15
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 52 318 3.0E-14
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 47 250 5.0E-13
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 51 509 2.0E-12
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 49 441 4.0E-10
sp|P27669|UHPC_SALTY Regulatory protein UhpC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=uhpC PE=3 SV=1 46 257 2.0E-09
sp|P09836|UHPC_ECOLI Regulatory protein UhpC OS=Escherichia coli (strain K12) GN=uhpC PE=1 SV=3 34 257 1.0E-08
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 38 252 4.0E-08
sp|P53241|VHT1_YEAST Vitamin H transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHT1 PE=1 SV=1 53 233 2.0E-07
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 57 233 3.0E-07
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 68 253 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

Domain # Start End Length
1 63 85 22
2 105 127 22
3 134 156 22
4 161 183 22
5 195 217 22
6 227 249 22
7 311 333 22
8 348 370 22
9 377 399 22
10 409 431 22
11 438 460 22
12 480 502 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|928
MFQKEPRPPDTGGKKPKASRYAASQVSPRPSSMSAPEESARFEADNDGDIIERIYKKLDRRIIPAFWLLYFLCSA
IRSSIGIAQTMNQAEKHDLMTMLDLSPKDVSLALALFYVSYVIFDFPSNLIMSKLSPRVWMARIVFATGLVGACF
AAVNDAWSLKLLRFLLGLVIAGMWPGMAFYLTLFYPPSRTGKRIGMYFTAAQVSAAVVGLVSAGFQLMDGAGGLV
GFRWMFLLYGLVAIVLSFVLLWWLPERPLAPGQERERSGWLKWLPPTPEALTGRDATIHYRDLRRVYHARPWTVQ
DLCYALLDWRLWPLCLMYFGVVGVGIGTQLYGSVIIKAIQPKATGIQVSLLFAPIWIMDLIAILIVTPLSDRFHR
YRALFFSGAVSIQIAGLLTTTFALDSGWARYGGLLMVGFGLGPTVPICMAWTAEVFQRRHGEVGVAAATALVSGL
GNLGSVTTTYALYSGWPKDAAPGRYQFRMSNLTMVAILVMSVASAILMTILLKAFGNQPSSKLYDGESVSENEDE
AAQRESRQRGFGTLDRIIMCQSFESGLFFRQQLS
Coding >Ophio5|928
ATGTTCCAAAAAGAACCGCGACCACCCGATACCGGCGGCAAAAAGCCTAAAGCAAGCCGATATGCCGCCAGTCAA
GTCTCGCCGAGGCCATCGTCGATGTCGGCGCCAGAGGAAAGCGCTCGGTTTGAGGCAGACAACGATGGCGACATC
ATCGAGCGCATCTACAAAAAGCTGGACAGGAGGATAATTCCCGCTTTCTGGCTTCTCTACTTTCTCTGTTCCGCT
ATTCGGTCCAGCATCGGCATCGCCCAGACGATGAACCAAGCCGAGAAGCACGACCTTATGACCATGCTCGATCTC
TCTCCCAAGGACGTGTCGTTGGCTCTCGCCCTCTTTTACGTCTCCTATGTCATCTTCGACTTTCCCTCCAACCTC
ATCATGAGCAAGCTGAGTCCTAGGGTCTGGATGGCCCGTATCGTCTTCGCTACCGGCCTTGTTGGTGCCTGCTTC
GCCGCAGTCAATGACGCCTGGTCCCTGAAGCTGCTGCGATTTCTGCTCGGTCTGGTCATCGCCGGCATGTGGCCG
GGAATGGCCTTTTACCTGACTCTCTTCTATCCGCCGTCGCGGACTGGAAAGCGCATCGGCATGTACTTTACCGCC
GCCCAGGTGTCTGCCGCCGTCGTCGGTTTGGTTTCGGCCGGCTTTCAGCTCATGGACGGCGCCGGGGGGCTCGTG
GGCTTCCGCTGGATGTTCCTCCTTTACGGTCTGGTCGCCATCGTACTCAGCTTCGTGCTCTTGTGGTGGCTGCCC
GAGCGCCCCTTGGCTCCTGGCCAGGAGAGGGAGCGTTCTGGCTGGCTGAAGTGGTTGCCGCCAACGCCTGAGGCT
CTCACCGGTCGTGATGCTACCATTCACTACCGCGATCTGCGCCGCGTCTACCATGCTCGCCCTTGGACAGTCCAA
GATTTGTGCTACGCCTTGCTGGACTGGCGGCTCTGGCCGCTGTGTTTAATGTACTTTGGCGTCGTCGGCGTTGGC
ATCGGCACCCAGCTGTACGGCTCCGTCATCATCAAAGCCATCCAGCCCAAAGCGACGGGTATTCAGGTTTCTCTT
CTTTTTGCTCCCATCTGGATTATGGATCTCATTGCCATTCTCATCGTCACGCCTCTTTCGGACCGCTTCCATCGC
TACCGGGCTTTGTTCTTCTCGGGAGCCGTCAGTATCCAGATTGCAGGGCTCCTTACAACGACCTTTGCATTAGAC
AGCGGATGGGCGCGCTACGGCGGACTCCTCATGGTAGGCTTTGGGTTGGGGCCGACGGTGCCTATCTGCATGGCC
TGGACGGCCGAGGTCTTTCAGCGTCGACACGGCGAGGTGGGCGTCGCCGCCGCTACCGCACTGGTTTCCGGACTG
GGCAACCTGGGCAGCGTGACGACAACTTATGCGCTCTACTCGGGCTGGCCGAAGGATGCGGCTCCCGGCAGGTAT
CAGTTCCGCATGAGCAATCTAACCATGGTTGCCATCCTCGTGATGAGCGTGGCGAGCGCGATCCTGATGACGATA
CTGCTCAAGGCCTTTGGCAACCAGCCGAGCTCCAAGCTGTACGATGGGGAGTCAGTGAGCGAGAATGAAGACGAG
GCTGCGCAGCGGGAGAGTCGGCAGCGTGGATTTGGAACGCTGGATAGAATCATTATGTGCCAGAGTTTTGAGTCG
GGTCTTTTCTTCCGGCAGCAACTTTCA
Transcript >Ophio5|928
ATGTTCCAAAAAGAACCGCGACCACCCGATACCGGCGGCAAAAAGCCTAAAGCAAGCCGATATGCCGCCAGTCAA
GTCTCGCCGAGGCCATCGTCGATGTCGGCGCCAGAGGAAAGCGCTCGGTTTGAGGCAGACAACGATGGCGACATC
ATCGAGCGCATCTACAAAAAGCTGGACAGGAGGATAATTCCCGCTTTCTGGCTTCTCTACTTTCTCTGTTCCGCT
ATTCGGTCCAGCATCGGCATCGCCCAGACGATGAACCAAGCCGAGAAGCACGACCTTATGACCATGCTCGATCTC
TCTCCCAAGGACGTGTCGTTGGCTCTCGCCCTCTTTTACGTCTCCTATGTCATCTTCGACTTTCCCTCCAACCTC
ATCATGAGCAAGCTGAGTCCTAGGGTCTGGATGGCCCGTATCGTCTTCGCTACCGGCCTTGTTGGTGCCTGCTTC
GCCGCAGTCAATGACGCCTGGTCCCTGAAGCTGCTGCGATTTCTGCTCGGTCTGGTCATCGCCGGCATGTGGCCG
GGAATGGCCTTTTACCTGACTCTCTTCTATCCGCCGTCGCGGACTGGAAAGCGCATCGGCATGTACTTTACCGCC
GCCCAGGTGTCTGCCGCCGTCGTCGGTTTGGTTTCGGCCGGCTTTCAGCTCATGGACGGCGCCGGGGGGCTCGTG
GGCTTCCGCTGGATGTTCCTCCTTTACGGTCTGGTCGCCATCGTACTCAGCTTCGTGCTCTTGTGGTGGCTGCCC
GAGCGCCCCTTGGCTCCTGGCCAGGAGAGGGAGCGTTCTGGCTGGCTGAAGTGGTTGCCGCCAACGCCTGAGGCT
CTCACCGGTCGTGATGCTACCATTCACTACCGCGATCTGCGCCGCGTCTACCATGCTCGCCCTTGGACAGTCCAA
GATTTGTGCTACGCCTTGCTGGACTGGCGGCTCTGGCCGCTGTGTTTAATGTACTTTGGCGTCGTCGGCGTTGGC
ATCGGCACCCAGCTGTACGGCTCCGTCATCATCAAAGCCATCCAGCCCAAAGCGACGGGTATTCAGGTTTCTCTT
CTTTTTGCTCCCATCTGGATTATGGATCTCATTGCCATTCTCATCGTCACGCCTCTTTCGGACCGCTTCCATCGC
TACCGGGCTTTGTTCTTCTCGGGAGCCGTCAGTATCCAGATTGCAGGGCTCCTTACAACGACCTTTGCATTAGAC
AGCGGATGGGCGCGCTACGGCGGACTCCTCATGGTAGGCTTTGGGTTGGGGCCGACGGTGCCTATCTGCATGGCC
TGGACGGCCGAGGTCTTTCAGCGTCGACACGGCGAGGTGGGCGTCGCCGCCGCTACCGCACTGGTTTCCGGACTG
GGCAACCTGGGCAGCGTGACGACAACTTATGCGCTCTACTCGGGCTGGCCGAAGGATGCGGCTCCCGGCAGGTAT
CAGTTCCGCATGAGCAATCTAACCATGGTTGCCATCCTCGTGATGAGCGTGGCGAGCGCGATCCTGATGACGATA
CTGCTCAAGGCCTTTGGCAACCAGCCGAGCTCCAAGCTGTACGATGGGGAGTCAGTGAGCGAGAATGAAGACGAG
GCTGCGCAGCGGGAGAGTCGGCAGCGTGGATTTGGAACGCTGGATAGAATCATTATGTGCCAGAGTTTTGAGTCG
GGTCTTTTCTTCCGGCAGCAACTTTCATGA
Gene >Ophio5|928
ATGTTCCAAAAAGAACCGCGACCACCCGATACCGGCGGCAAAAAGCCTAAAGCAAGCCGATATGCCGCCAGTCAA
GTCTCGCCGAGGCCATCGTCGATGTCGGCGCCAGAGGAAAGCGCTCGGTTTGAGGCAGACAACGATGGCGACATC
ATCGAGCGCATCTACAAGTGAGCAGCGGTCACGACCGACTCGATGCCCTCGCATGCTTACGATTGGCTGCAGAAA
GCTGGACAGGAGGATAATTCCCGGTTGGCTTAATCGCTTTCCAGTGAGGTTGACTTTCGCTCACGCTGGATGCAG
CTTTCTGGCTTCTCTACTTTCTCTGTTCCGCTATTCGGTCCAGCATCGGCATCGCCCAGACGATGAACCAAGCCG
AGAAGCACGACCTTATGACCATGCTCGATCTCTCTCCCAAGGACGTGTCGTTGGCTCTCGCCCTCTTTTACGTCT
CCTATGTCATCTTCGACTTTCCCTCCAACCTCATCATGAGCAAGCTGAGTCCTAGGGTCTGGATGGCCCGTATCG
TCTTCGCTACCGGCCTTGTTGGTGCCTGCTTCGCCGCAGTCAATGACGCCTGGTCCCTGAAGCTGCTGCGATTTC
TGCTCGGTCTGGTCATCGCCGGCATGTGGCCGGGAATGGCCTTTTACCTGACTCTCTTCTATCCGCCGTCGCGGA
CTGGAAAGCGCATCGGCATGTACTTTACCGCCGCCCAGGTGTCTGCCGCCGTCGTCGGTTTGGTTTCGGCCGGCT
TTCAGCTCATGGACGGCGCCGGGGGGCTCGTGGGCTTCCGCTGGATGTTCCTCCTTTACGGTCTGGTCGCCATCG
TACTCAGCTTCGTGCTCTTGTGGTGGCTGCCCGAGCGCCCCTTGGCTCCTGGCCAGGAGAGGGAGCGTTCTGGCT
GGCTGAAGTGGTTGCCGCCAACGCCTGAGGCTCTCACCGGTCGTGATGCTACCATTCACTACCGCGATCTGCGCC
GCGTCTACCATGCTCGCCCTTGGACAGTCCAAGATTTGTGCTACGCCTTGCTGGACTGGCGGCTCTGGCCGCTGT
GTTTAATGTACTTTGGCGTCGTCGGCGTTGGCATCGGCACCCAGCTGTACGGCTCCGTCATCATCAAAGCCATCC
AGCCCAAAGCGACGGGTATTCAGGTTTCTCTTCTTTTTGCTCCCATCTGGATTGTAAGTTTCTTCCGTTTCGCCA
ATTGAGTATGCCTGTCCGCCTGACAGAGGTTGATGACAGATGGATCTCATTGCCATTCTCATCGTCACGCCTCTT
TCGGACCGCTTCCATCGCTACCGGGCTTTGTTCTTCTCGGGAGCCGTCAGTATCCAGATTGCAGGGCTCCTTACA
ACGACCTTTGCATTAGACAGCGGATGGGCGCGCTACGGCGGACTCCTCATGGTAGGCTTTGGGTTGGGGCCGACG
GTGCCTATCTGCATGGCCTGGACGGCCGAGGTCTTTCAGCGTCGACACGGCGAGGTGGGCGTCGCCGCCGCTACC
GCACTGGTTTCCGGACTGGGCAACCTGGGCAGCGTGACGACAACTTATGCGCTCTACTCGGGCTGGCCGAAGGAT
GCGGCTCCCGGCAGGTATCAGTTCCGCATGAGCAATCTAACCATGGTTGCCATCCTCGTGATGAGCGTGGCGAGC
GCGATCCTGATGACGATACTGCTCAAGGCCTTTGGCAACCAGCCGAGCTCCAAGCTGTACGATGGGGAGTCAGTG
AGCGAGAATGAAGACGAGGCTGCGCAGCGGGAGAGTCGGCAGCGTGGATTTGGAACGCTGGGTAAGTGGTGGACG
TCTCGACGGGCTATACCGCGTTGATGTCCATGGCTTGTTACGCACTAGCCATAGATAGAATCATTATGGTGAACA
CTCCAACTTGCTGCGTGTCATGTCTTGTTTGGCTGATGTCCGCCAGTGCCAGAGTTTTGAGTCGGGTCTTTTCTT
CCGGCAGCAACTTTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail