Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|922
Gene name
Locationscaffold_128:4067..4600
Strand-
Gene length (bp)533
Transcript length (bp)333
Coding sequence length (bp)330
Protein length (aa) 110

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00428 Ribosomal_60s 60s Acidic ribosomal protein 4.4E-26 22 109

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49148|RLA1_ALTAL 60S acidic ribosomal protein P1 OS=Alternaria alternata GN=ALTA12 PE=1 SV=1 4 110 7.0E-36
sp|Q9HGV0|RLA1_ASPFU 60S acidic ribosomal protein P1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_1G06830 PE=3 SV=1 4 110 3.0E-31
sp|P50344|RLA1_DAVTA 60S acidic ribosomal protein P1 OS=Davidiella tassiana GN=CLAH12 PE=1 SV=1 5 110 3.0E-30
sp|P17476|RLA1_SCHPO 60S acidic ribosomal protein P1-alpha 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpp101 PE=3 SV=1 5 110 5.0E-28
sp|P17477|RLA3_SCHPO 60S acidic ribosomal protein P1-alpha 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpp102 PE=3 SV=1 5 110 7.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49148|RLA1_ALTAL 60S acidic ribosomal protein P1 OS=Alternaria alternata GN=ALTA12 PE=1 SV=1 4 110 7.0E-36
sp|Q9HGV0|RLA1_ASPFU 60S acidic ribosomal protein P1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_1G06830 PE=3 SV=1 4 110 3.0E-31
sp|P50344|RLA1_DAVTA 60S acidic ribosomal protein P1 OS=Davidiella tassiana GN=CLAH12 PE=1 SV=1 5 110 3.0E-30
sp|P17476|RLA1_SCHPO 60S acidic ribosomal protein P1-alpha 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpp101 PE=3 SV=1 5 110 5.0E-28
sp|P17477|RLA3_SCHPO 60S acidic ribosomal protein P1-alpha 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpp102 PE=3 SV=1 5 110 7.0E-28
sp|Q9UU78|RLA5_SCHPO 60S acidic ribosomal protein P1-alpha 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpp103 PE=1 SV=1 5 110 3.0E-25
sp|P08570|RLA1_DROME 60S acidic ribosomal protein P1 OS=Drosophila melanogaster GN=RpLP1 PE=1 SV=2 1 110 3.0E-21
sp|O23095|RLA12_ARATH 60S acidic ribosomal protein P1-2 OS=Arabidopsis thaliana GN=RPP1B PE=1 SV=2 1 110 5.0E-20
sp|P05318|RLA1_YEAST 60S acidic ribosomal protein P1-alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPP1A PE=1 SV=4 4 110 9.0E-19
sp|O01359|RLA1_OSCTI 60S acidic ribosomal protein P1 OS=Oscheius tipulae GN=rpl-21 PE=3 SV=1 1 110 1.0E-18
sp|Q8LCW9|RLA11_ARATH 60S acidic ribosomal protein P1-1 OS=Arabidopsis thaliana GN=RPP1A PE=2 SV=2 1 110 2.0E-18
sp|Q8LEQ0|RLA13_ARATH 60S acidic ribosomal protein P1-3 OS=Arabidopsis thaliana GN=RPP1C PE=1 SV=2 1 110 4.0E-18
sp|Q9HFQ7|RLA1_CANAL 60S acidic ribosomal protein P1-A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPP1A PE=3 SV=1 4 110 1.0E-16
sp|P91913|RLA1_CAEEL 60S acidic ribosomal protein P1 OS=Caenorhabditis elegans GN=rla-1 PE=3 SV=2 1 110 7.0E-16
sp|P52855|RLA1_MAIZE 60S acidic ribosomal protein P1 OS=Zea mays GN=RPP1A PE=1 SV=1 6 110 1.0E-15
sp|P10622|RLA3_YEAST 60S acidic ribosomal protein P1-beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPP1B PE=1 SV=3 10 110 2.0E-14
sp|P18660|RLA1_CHICK 60S acidic ribosomal protein P1 OS=Gallus gallus GN=RPLP1 PE=3 SV=1 1 110 1.0E-13
sp|P05386|RLA1_HUMAN 60S acidic ribosomal protein P1 OS=Homo sapiens GN=RPLP1 PE=1 SV=1 1 110 4.0E-13
sp|Q56K14|RLA1_BOVIN 60S acidic ribosomal protein P1 OS=Bos taurus GN=RPLP1 PE=3 SV=1 1 110 4.0E-13
sp|A1XQU7|RLA1_PIG 60S acidic ribosomal protein P1 OS=Sus scrofa GN=RPLP1 PE=3 SV=1 1 110 9.0E-13
sp|P02402|RLA1_ARTSA 60S acidic ribosomal protein P1 OS=Artemia salina PE=1 SV=2 1 64 1.0E-12
sp|P19944|RLA1_RAT 60S acidic ribosomal protein P1 OS=Rattus norvegicus GN=Rplp1 PE=3 SV=1 1 110 4.0E-12
sp|P47955|RLA1_MOUSE 60S acidic ribosomal protein P1 OS=Mus musculus GN=Rplp1 PE=1 SV=1 1 110 5.0E-12
sp|Q9HFQ6|RLA3_CANAX 60S acidic ribosomal protein P1-B OS=Candida albicans GN=RPP1B PE=1 SV=1 4 110 6.0E-12
sp|P29763|RLA1_CHLRE 60S acidic ribosomal protein P1 OS=Chlamydomonas reinhardtii PE=3 SV=1 4 110 3.0E-11
sp|P27464|RLA1_POLPE 60S acidic ribosomal protein P1 OS=Polyorchis penicillatus PE=3 SV=1 2 64 5.0E-10
sp|P22684|RLA1_DICDI 60S acidic ribosomal protein P1 OS=Dictyostelium discoideum GN=rplp1 PE=3 SV=1 4 110 4.0E-09
sp|O46313|RLA1_LEIPE 60S acidic ribosomal protein P1 OS=Leishmania peruviana PE=3 SV=1 4 110 1.0E-07
sp|P26643|RLA1_TRYCR 60S acidic ribosomal protein P1 OS=Trypanosoma cruzi PE=3 SV=1 1 110 2.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.6304 0.2908 0.0391 0.1216 0.0534 0.0063 0.0865 0.305 0.3591 0.0061

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3833
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5741
Ophiocordyceps australis map64 (Brazil) OphauB2|4858
Ophiocordyceps camponoti-floridani Ophcf2|06868
Ophiocordyceps camponoti-rufipedis Ophun1|4742
Ophiocordyceps kimflemingae Ophio5|922 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7540

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|922
MSHTAELAASYAALILADEGVEVSSDKLQSLIKAANVADVEPIWTSIFAKALEGKDVKDLLVNVGSGGGAAPAAG
GATAAGGDAAAPAAEEKKEEEKEESDEDMGFGLFD
Coding >Ophio5|922
ATGTCTCACACTGCCGAGCTCGCCGCCTCCTACGCGGCGCTGATTCTCGCCGATGAGGGCGTCGAGGTCTCGTCC
GACAAGCTCCAGTCCCTGATCAAGGCTGCCAACGTGGCCGACGTCGAGCCCATATGGACCTCCATCTTCGCCAAG
GCGCTCGAGGGCAAGGATGTCAAGGATCTGCTTGTCAACGTCGGCTCCGGTGGCGGTGCTGCCCCGGCCGCTGGA
GGTGCTACTGCTGCCGGAGGTGACGCTGCCGCTCCCGCCGCGGAGGAGAAGAAGGAAGAGGAGAAGGAGGAGTCG
GACGAGGATATGGGCTTCGGTCTCTTCGAC
Transcript >Ophio5|922
ATGTCTCACACTGCCGAGCTCGCCGCCTCCTACGCGGCGCTGATTCTCGCCGATGAGGGCGTCGAGGTCTCGTCC
GACAAGCTCCAGTCCCTGATCAAGGCTGCCAACGTGGCCGACGTCGAGCCCATATGGACCTCCATCTTCGCCAAG
GCGCTCGAGGGCAAGGATGTCAAGGATCTGCTTGTCAACGTCGGCTCCGGTGGCGGTGCTGCCCCGGCCGCTGGA
GGTGCTACTGCTGCCGGAGGTGACGCTGCCGCTCCCGCCGCGGAGGAGAAGAAGGAAGAGGAGAAGGAGGAGTCG
GACGAGGATATGGGCTTCGGTCTCTTCGACTAA
Gene >Ophio5|922
ATGTCTCACACTGCCGAGCTCGCCGCCTCCTACGCGGCGCTGATTCTCGCCGATGAGGGCGTCGAGGTCTCGGTA
AATTACCTCGGGGCGCGAACGCGCAAACCGGGCGCTAAAACCATAACAGTCCGACAAGCTCCAGTCCCTGATCAA
GGCTGCCAACGTGGCCGACGTCGAGCCCATATGGACCTCCATCTTCGCCAAGGTACGACTTATCTTCTCCCATGT
CGCGAATGGCCCGGAAAAGACGATGTGGACGGGACGGCCATTCATCGAACCGGCTGACTCTGGTTACAGGCGCTC
GAGGGCAAGGATGTCAAGGATCTGCTTGTCAACGTCGGCTCCGGTGGCGGTGCTGCCCCGGCCGCTGGAGGTGCT
ACTGCTGCCGGAGGTGACGCTGCCGCTCCCGCCGCGGAGGAGAAGAAGGAAGAGGGTACGTTGCTTTGTATTCTA
CGGGCTGCGGCGAGCTCTACTGACAAACTACCTCAGAGAAGGAGGAGTCGGACGAGGATATGGGCTTCGGTCTCT
TCGACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail