Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|920
Gene name
Locationscaffold_128:238..1409
Strand-
Gene length (bp)1171
Transcript length (bp)846
Coding sequence length (bp)843
Protein length (aa) 281

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00635 Motile_Sperm MSP (Major sperm protein) domain 6.7E-25 3 95

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60119|YH75_SCHPO Vesicle-associated membrane protein-associated protein C16G5.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16G5.05c PE=1 SV=1 1 121 4.0E-25
sp|Q10484|YDFC_SCHPO Uncharacterized protein C17C9.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17C9.12 PE=1 SV=2 1 132 5.0E-25
sp|P40075|SCS2_YEAST Vesicle-associated membrane protein-associated protein SCS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCS2 PE=1 SV=3 2 125 7.0E-21
sp|Q84WW5|VAP13_ARATH Vesicle-associated protein 1-3 OS=Arabidopsis thaliana GN=PVA13 PE=2 SV=1 3 135 3.0E-20
sp|B9DHD7|VAP22_ARATH Vesicle-associated protein 2-2 OS=Arabidopsis thaliana GN=PVA22 PE=1 SV=1 3 138 6.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60119|YH75_SCHPO Vesicle-associated membrane protein-associated protein C16G5.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16G5.05c PE=1 SV=1 1 121 4.0E-25
sp|Q10484|YDFC_SCHPO Uncharacterized protein C17C9.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17C9.12 PE=1 SV=2 1 132 5.0E-25
sp|P40075|SCS2_YEAST Vesicle-associated membrane protein-associated protein SCS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCS2 PE=1 SV=3 2 125 7.0E-21
sp|Q84WW5|VAP13_ARATH Vesicle-associated protein 1-3 OS=Arabidopsis thaliana GN=PVA13 PE=2 SV=1 3 135 3.0E-20
sp|B9DHD7|VAP22_ARATH Vesicle-associated protein 2-2 OS=Arabidopsis thaliana GN=PVA22 PE=1 SV=1 3 138 6.0E-20
sp|Q5R601|VAPA_PONAB Vesicle-associated membrane protein-associated protein A OS=Pongo abelii GN=VAPA PE=2 SV=2 7 118 5.0E-19
sp|Q9P0L0|VAPA_HUMAN Vesicle-associated membrane protein-associated protein A OS=Homo sapiens GN=VAPA PE=1 SV=3 7 118 5.0E-19
sp|Q9Z270|VAPA_RAT Vesicle-associated membrane protein-associated protein A OS=Rattus norvegicus GN=Vapa PE=1 SV=3 7 118 1.0E-18
sp|Q9WV55|VAPA_MOUSE Vesicle-associated membrane protein-associated protein A OS=Mus musculus GN=Vapa PE=1 SV=2 7 118 2.0E-18
sp|Q0VCY1|VAPA_BOVIN Vesicle-associated membrane protein-associated protein A OS=Bos taurus GN=VAPA PE=2 SV=1 7 118 2.0E-18
sp|Q9Z269|VAPB_RAT Vesicle-associated membrane protein-associated protein B OS=Rattus norvegicus GN=Vapb PE=1 SV=3 3 96 3.0E-18
sp|Q9SHC8|VAP12_ARATH Vesicle-associated protein 1-2 OS=Arabidopsis thaliana GN=PVA12 PE=1 SV=1 5 135 6.0E-18
sp|Q16943|VP33_APLCA Vesicle-associated membrane protein/synaptobrevin-binding protein OS=Aplysia californica PE=2 SV=1 9 136 9.0E-18
sp|A2VDZ9|VAPB_BOVIN Vesicle-associated membrane protein-associated protein B OS=Bos taurus GN=VAPB PE=2 SV=1 3 162 9.0E-18
sp|Q9QY76|VAPB_MOUSE Vesicle-associated membrane protein-associated protein B OS=Mus musculus GN=Vapb PE=1 SV=3 3 96 1.0E-17
sp|Q8VZ95|VAP11_ARATH Vesicle-associated protein 1-1 OS=Arabidopsis thaliana GN=PVA11 PE=1 SV=1 5 135 1.0E-17
sp|A5GFS8|VAPB_PIG Vesicle-associated membrane protein-associated protein B OS=Sus scrofa GN=VAPB PE=3 SV=1 3 98 1.0E-17
sp|O95292|VAPB_HUMAN Vesicle-associated membrane protein-associated protein B/C OS=Homo sapiens GN=VAPB PE=1 SV=3 5 96 2.0E-17
sp|Q9LVU1|VAP21_ARATH Vesicle-associated protein 2-1 OS=Arabidopsis thaliana GN=PVA21 PE=1 SV=1 3 122 8.0E-14
sp|O82213|VAP31_ARATH Vesicle-associated protein 3-1 OS=Arabidopsis thaliana GN=PVA31 PE=3 SV=1 3 135 4.0E-12
sp|Q9SYC9|VAP14_ARATH Vesicle-associated protein 1-4 OS=Arabidopsis thaliana GN=PVA14 PE=2 SV=1 5 135 7.0E-12
sp|Q6Q595|SCS22_YEAST Vesicle-associated membrane protein-associated protein SCS22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCS22 PE=1 SV=2 3 145 2.0E-11
sp|Q9SYC9|VAP14_ARATH Vesicle-associated protein 1-4 OS=Arabidopsis thaliana GN=PVA14 PE=2 SV=1 5 125 2.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 261 280 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 158.31 86.22 230.40
CcL In ants, during behavior modification 320.15 161.40 478.90
CcD In ants, recently dead 226.75 121.04 332.45

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.001851 yes
SC16a CcD 0.124361 no
CcL CcD 0.155711 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|920
MSVEIDPQDLNFRRPFTVEVSQILTIKNPTTTPLAFKVKTTAPKQYCVRPNAGRIEPGQCFDVTVLLQAMKADPP
LDAKCRDKFLVQSAPITSDKEFASIALVLDSTEKDRIQERKIRVNWLPAPGSDGATAPQAGTVTPNRQSMVNGRS
ATDTPTSRAYSSPRGASDSNPAPSYSAESSYDHGDGKSEHPKSAVSQAATAVSESAQVTYEELKAKLAQAEAQIV
MLKDNTLRQRSAKPGANEGKVASSPIAQAVKQVDGVPVQAVAILCLLSFLLAYFFF
Coding >Ophio5|920
ATGTCCGTCGAAATCGATCCTCAGGACCTAAACTTCCGCCGCCCCTTTACGGTTGAGGTGTCGCAGATCTTGACC
ATCAAGAACCCGACCACGACACCGCTTGCCTTTAAGGTCAAGACAACTGCTCCAAAACAATACTGCGTTCGACCG
AACGCGGGCCGAATCGAGCCGGGCCAGTGTTTCGATGTAACCGTGCTCCTGCAGGCCATGAAGGCCGACCCTCCC
CTTGATGCCAAGTGTCGCGACAAGTTTCTCGTCCAGTCGGCGCCCATTACATCCGACAAGGAGTTTGCGAGCATC
GCTTTGGTGCTCGATTCAACGGAAAAGGATCGAATTCAAGAGCGCAAAATCCGTGTCAACTGGCTGCCTGCTCCC
GGCTCAGATGGTGCTACCGCCCCACAAGCTGGAACCGTGACTCCCAACAGGCAGTCGATGGTGAATGGGCGCAGC
GCCACCGACACACCAACGTCGCGCGCCTACTCGTCTCCAAGAGGCGCGAGCGACTCGAATCCAGCTCCTTCCTAC
TCGGCCGAGAGTTCGTACGATCATGGAGACGGCAAGTCGGAACACCCCAAGTCGGCCGTGTCTCAAGCCGCCACG
GCTGTCTCCGAATCGGCCCAAGTGACGTATGAAGAACTCAAAGCCAAGCTGGCCCAGGCCGAGGCCCAGATTGTG
ATGCTCAAGGACAATACGCTCCGCCAGCGCAGCGCCAAGCCCGGGGCCAACGAGGGCAAGGTGGCGAGCAGCCCC
ATCGCGCAGGCCGTCAAGCAGGTCGATGGCGTGCCTGTGCAGGCAGTTGCCATTCTCTGTCTACTGAGCTTCCTC
CTCGCCTACTTTTTCTTC
Transcript >Ophio5|920
ATGTCCGTCGAAATCGATCCTCAGGACCTAAACTTCCGCCGCCCCTTTACGGTTGAGGTGTCGCAGATCTTGACC
ATCAAGAACCCGACCACGACACCGCTTGCCTTTAAGGTCAAGACAACTGCTCCAAAACAATACTGCGTTCGACCG
AACGCGGGCCGAATCGAGCCGGGCCAGTGTTTCGATGTAACCGTGCTCCTGCAGGCCATGAAGGCCGACCCTCCC
CTTGATGCCAAGTGTCGCGACAAGTTTCTCGTCCAGTCGGCGCCCATTACATCCGACAAGGAGTTTGCGAGCATC
GCTTTGGTGCTCGATTCAACGGAAAAGGATCGAATTCAAGAGCGCAAAATCCGTGTCAACTGGCTGCCTGCTCCC
GGCTCAGATGGTGCTACCGCCCCACAAGCTGGAACCGTGACTCCCAACAGGCAGTCGATGGTGAATGGGCGCAGC
GCCACCGACACACCAACGTCGCGCGCCTACTCGTCTCCAAGAGGCGCGAGCGACTCGAATCCAGCTCCTTCCTAC
TCGGCCGAGAGTTCGTACGATCATGGAGACGGCAAGTCGGAACACCCCAAGTCGGCCGTGTCTCAAGCCGCCACG
GCTGTCTCCGAATCGGCCCAAGTGACGTATGAAGAACTCAAAGCCAAGCTGGCCCAGGCCGAGGCCCAGATTGTG
ATGCTCAAGGACAATACGCTCCGCCAGCGCAGCGCCAAGCCCGGGGCCAACGAGGGCAAGGTGGCGAGCAGCCCC
ATCGCGCAGGCCGTCAAGCAGGTCGATGGCGTGCCTGTGCAGGCAGTTGCCATTCTCTGTCTACTGAGCTTCCTC
CTCGCCTACTTTTTCTTCTAG
Gene >Ophio5|920
ATGTCCGTCGAAATCGATCCTCAGGACCTAAACTTCCGCCGTGAGTTCTGTTCCATCACCGGAGCTGGTATTGGC
GCATGCTGATCAACTTCCAGGCCCCTTTACGGTTGAGGTGTCGCAGATCTTGACCATCAAGAACCCGACCACGAC
ACCGCTTGCCTTTAAGGTACTGTTTTCCAAACTTGATACTGTCCAAGCCGCTTCTGTGAACCCTGCTAAACCCGT
CGTCAGGTCAAGACAACTGCTCCAAAACAGTTCGTTCAACTTGCTTCTCTCCCCTCGTTCAACCTCTGATCGTTG
ATCTAGATACTGCGTTCGACCGAACGCGGGCCGAATCGAGCCGGGCCAGTGTTTCGATGTAACCGGTACGCATCC
TTGCCTGCTCGTTGACGCTCTCAGGTTAACCTGGTCACAGTGCTCCTGCAGGCCATGAAGGCCGACCCTCCCCTT
GATGCCAAGTGTCGCGACAAGTTTCTCGTCCAGTCGGCGCCCATTACATCCGACAAGGAGTTTGCGAGCATCGCT
TTGGTGGTGAGTACAGTTTATTCATATTAGAGGACGAGCTGACCATTTGCAGCTCGATTCAACGGAAAAGGATCG
AATTCAAGAGCGCAAAATCCGTGTCAACTGGCTGCCTGCTCCCGGCTCAGATGGTGCTACCGCCCCACAAGCTGG
AACCGTGACTCCCAACAGGCAGTCGATGGTGAATGGGGTAAGTGCTTTTGCAGACATCAAGCAGGCCGTCTCTAA
CAGGACACGGCTACCTCAGCGCAGCGCCACCGACACACCAACGTCGCGCGCCTACTCGTCTCCAAGAGGCGCGAG
CGACTCGAATCCAGCTCCTTCCTACTCGGCCGAGAGTTCGTACGATCATGGAGACGGCAAGTCGGAACACCCCAA
GTCGGCCGTGTCTCAAGCCGCCACGGCTGTCTCCGAATCGGCCCAAGTGACGTATGAAGAACTCAAAGCCAAGCT
GGCCCAGGCCGAGGCCCAGATTGTGATGCTCAAGGACAATACGCTCCGCCAGCGCAGCGCCAAGCCCGGGGCCAA
CGAGGGCAAGGTGGCGAGCAGCCCCATCGCGCAGGCCGTCAAGCAGGTCGATGGCGTGCCTGTGCAGGCAGTTGC
CATTCTCTGTCTACTGAGCTTCCTCCTCGCCTACTTTTTCTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail