Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|92
Gene name
Locationscaffold_10:60306..63093
Strand+
Gene length (bp)2787
Transcript length (bp)2472
Coding sequence length (bp)2469
Protein length (aa) 823

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20400 BAR_4 BAR-like domain 9.5E-65 250 432
PF20399 PH_20 PH domain 3.2E-31 450 529

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53955|SLM2_YEAST Phosphatidylinositol 4,5-bisphosphate-binding protein SLM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLM2 PE=1 SV=1 189 558 5.0E-77
sp|Q06108|RGC1_YEAST Regulator of the glycerol channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGC1 PE=1 SV=1 248 495 2.0E-35
sp|P48361|ASK10_YEAST Activator of SKN7 protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASK10 PE=1 SV=2 248 495 6.0E-32
sp|O94447|SLM1_SCHPO Cytoskeletal signaling protein slm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slm1 PE=1 SV=1 199 557 6.0E-30

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|92
MDPTSSLESRAPPSRQATQTPEPNLHQHHHQSQAAHQQQQQQQQQTPRRQQQKQKPQPSSQPEQQSQQQPSQKQP
LLQKQQQQQNSPPRGSPAPDRFNEDRDANQRSISVVDGQVRSRSTSAMQRSGSLRSFATGDDRSLPVRSNTLRKR
TSMRRSSSRRSNRAGSVRSLAVQTAPDSDDVSNAFYCPVPTSGTPTDVLANRFQVWRKILKDVIAYFREIQSHYE
QRAKSLFKLVNLGNNIATPPNFLSTGGIDDALQLLRKHNHAALQEASKAKEIEDDVILALTGLRSDLQQKIKEIR
HLAGDFKNSVDREIEGTQKAVRALADALEKTEIDSAFTTGKQDPYLLRLAVDQQVERQIDEENYLHQAHLNLEGS
GRELESIVVGEIQKAYNAYAGILKREAENAYNAVEELRQGPINMPKDQEWNHFVKHDDQIIDPNIPMRSADQIHY
PGQDHVAASEIRAGLLERKSKYLKSYTAGWYVLSATHLHEFKSADKAQAPVMSLYLPEQKLGSHSAEGGASNKFV
LKGRQTGAMHRGHTWVFRAESHDTMMAWYDDIQLEPIVAPIGQQRRHRRRGRRGAIRGQPDRRRPRTGTPTARTS
VNTGRQEETLDAHAIAVSGAAYAASSGSEEHGQQEDHGRRRQHHQGHGGMDGGMPSQAAVAGYEGHGSVVKPANG
DVVQKGGGKSPNSGGLARPSLSPTSVKGERPVSDDDRARYMDERKMIDAEVEARGVDSNSSGLHGAYCVNGGAVT
DLTSAGSVPRSEKRMSLPEARIVAHAMAKGEATPPPLTERPVAEVRTDSAATLSNLPMPGRFPRRGGGVLSST
Coding >Ophio5|92
ATGGATCCTACTAGTAGTCTCGAATCGCGGGCGCCGCCGTCGCGTCAGGCGACTCAGACCCCGGAGCCCAATCTC
CACCAGCATCATCATCAGTCGCAAGCTGCCCACCAACAACAACAACAACAACAACAACAGACCCCACGAAGGCAA
CAGCAGAAGCAGAAGCCTCAGCCTTCTTCTCAACCTGAGCAGCAGTCTCAACAGCAGCCCTCTCAGAAACAACCC
CTGCTTCAGAAGCAGCAGCAGCAGCAGAACTCACCGCCAAGAGGCTCCCCCGCGCCCGACAGATTCAACGAGGAT
CGGGACGCCAACCAGCGCAGCATCTCCGTCGTCGACGGCCAGGTCAGGTCCAGGTCTACCTCGGCCATGCAGCGA
TCCGGCTCGCTTCGCAGTTTCGCCACTGGCGACGACCGCTCCCTACCCGTCCGGAGCAACACTTTGAGGAAGAGA
ACCTCGATGCGCCGCAGCAGCAGCCGCCGCAGTAACCGAGCCGGCAGCGTCCGCAGTCTCGCCGTCCAGACTGCT
CCGGACTCGGACGACGTCTCCAACGCCTTCTACTGCCCCGTGCCCACCTCCGGCACGCCTACCGACGTCCTCGCC
AATAGATTCCAAGTATGGAGAAAAATCCTCAAGGATGTCATCGCCTACTTTCGCGAGATACAGTCTCACTACGAG
CAGCGAGCAAAGAGCCTCTTCAAACTCGTTAACCTCGGAAACAACATCGCCACGCCTCCCAATTTCCTCAGCACT
GGCGGCATCGACGACGCCCTCCAGTTGCTACGCAAGCACAACCACGCGGCCCTGCAGGAGGCCAGCAAGGCCAAG
GAGATTGAGGACGACGTCATTCTCGCTCTGACCGGACTCCGCAGCGATCTCCAGCAAAAGATCAAGGAGATCCGC
CATCTTGCCGGCGATTTCAAGAATTCGGTCGACCGCGAAATCGAGGGCACGCAAAAAGCGGTGCGCGCCCTCGCC
GACGCCCTTGAGAAGACGGAAATCGACTCAGCCTTCACCACCGGCAAGCAGGATCCCTACCTGCTGCGTCTCGCC
GTCGACCAGCAGGTGGAGCGCCAGATTGACGAAGAGAACTACCTCCACCAGGCCCACCTCAACCTCGAGGGATCA
GGCCGCGAGCTCGAGTCCATCGTCGTGGGTGAAATCCAGAAAGCTTACAATGCCTACGCCGGCATCCTGAAGCGC
GAGGCGGAAAATGCATACAATGCTGTCGAGGAGCTACGCCAGGGCCCCATAAACATGCCCAAGGATCAGGAGTGG
AACCACTTCGTAAAGCACGATGATCAGATCATCGATCCCAACATCCCCATGCGATCCGCCGACCAGATCCACTAT
CCGGGTCAGGATCACGTTGCCGCCTCGGAGATTCGCGCCGGCCTCCTGGAACGGAAGAGCAAGTATCTCAAGAGC
TACACGGCTGGCTGGTATGTACTTTCCGCCACTCATCTGCACGAGTTCAAGTCGGCGGACAAGGCCCAGGCCCCC
GTCATGTCGCTCTACTTGCCGGAGCAGAAGCTGGGCTCGCACTCGGCCGAGGGTGGAGCGTCCAACAAGTTCGTC
CTCAAGGGCCGCCAGACGGGTGCCATGCACCGAGGACACACCTGGGTCTTCCGAGCCGAGAGTCATGATACCATG
ATGGCCTGGTACGACGACATCCAGCTTGAGCCGATCGTCGCGCCGATCGGCCAGCAGCGACGGCATCGTCGACGA
GGACGACGAGGAGCCATTCGCGGCCAACCGGATCGACGTCGCCCCCGAACCGGCACCCCGACGGCCCGAACCAGT
GTAAATACGGGTCGCCAGGAGGAAACGTTGGACGCTCACGCCATCGCCGTCTCGGGAGCCGCGTACGCCGCCTCG
TCCGGCAGCGAGGAGCATGGACAGCAGGAGGACCATGGCCGCCGCCGTCAGCACCATCAAGGACACGGTGGAATG
GATGGGGGCATGCCGTCACAGGCAGCCGTTGCCGGCTACGAGGGACATGGCAGCGTCGTGAAGCCCGCAAATGGT
GACGTCGTTCAGAAGGGCGGCGGCAAGAGCCCTAATTCTGGCGGCTTGGCGAGGCCCTCGCTCAGCCCGACGAGC
GTGAAGGGAGAACGGCCAGTCAGCGACGACGACCGGGCGCGATACATGGACGAGCGCAAGATGATCGACGCCGAA
GTGGAGGCTCGAGGCGTCGACAGCAACAGCAGCGGTCTCCACGGCGCCTACTGCGTCAACGGCGGGGCCGTAACA
GATTTGACGTCGGCGGGAAGCGTCCCGAGGTCGGAGAAGCGGATGTCGCTGCCCGAGGCCCGCATCGTCGCCCAC
GCCATGGCCAAGGGCGAGGCGACGCCGCCGCCGTTGACGGAGCGGCCGGTGGCCGAGGTCCGGACGGACAGCGCG
GCGACGCTGTCGAACCTGCCGATGCCTGGCAGGTTTCCCCGCCGAGGCGGTGGAGTCTTGTCGTCGACG
Transcript >Ophio5|92
ATGGATCCTACTAGTAGTCTCGAATCGCGGGCGCCGCCGTCGCGTCAGGCGACTCAGACCCCGGAGCCCAATCTC
CACCAGCATCATCATCAGTCGCAAGCTGCCCACCAACAACAACAACAACAACAACAACAGACCCCACGAAGGCAA
CAGCAGAAGCAGAAGCCTCAGCCTTCTTCTCAACCTGAGCAGCAGTCTCAACAGCAGCCCTCTCAGAAACAACCC
CTGCTTCAGAAGCAGCAGCAGCAGCAGAACTCACCGCCAAGAGGCTCCCCCGCGCCCGACAGATTCAACGAGGAT
CGGGACGCCAACCAGCGCAGCATCTCCGTCGTCGACGGCCAGGTCAGGTCCAGGTCTACCTCGGCCATGCAGCGA
TCCGGCTCGCTTCGCAGTTTCGCCACTGGCGACGACCGCTCCCTACCCGTCCGGAGCAACACTTTGAGGAAGAGA
ACCTCGATGCGCCGCAGCAGCAGCCGCCGCAGTAACCGAGCCGGCAGCGTCCGCAGTCTCGCCGTCCAGACTGCT
CCGGACTCGGACGACGTCTCCAACGCCTTCTACTGCCCCGTGCCCACCTCCGGCACGCCTACCGACGTCCTCGCC
AATAGATTCCAAGTATGGAGAAAAATCCTCAAGGATGTCATCGCCTACTTTCGCGAGATACAGTCTCACTACGAG
CAGCGAGCAAAGAGCCTCTTCAAACTCGTTAACCTCGGAAACAACATCGCCACGCCTCCCAATTTCCTCAGCACT
GGCGGCATCGACGACGCCCTCCAGTTGCTACGCAAGCACAACCACGCGGCCCTGCAGGAGGCCAGCAAGGCCAAG
GAGATTGAGGACGACGTCATTCTCGCTCTGACCGGACTCCGCAGCGATCTCCAGCAAAAGATCAAGGAGATCCGC
CATCTTGCCGGCGATTTCAAGAATTCGGTCGACCGCGAAATCGAGGGCACGCAAAAAGCGGTGCGCGCCCTCGCC
GACGCCCTTGAGAAGACGGAAATCGACTCAGCCTTCACCACCGGCAAGCAGGATCCCTACCTGCTGCGTCTCGCC
GTCGACCAGCAGGTGGAGCGCCAGATTGACGAAGAGAACTACCTCCACCAGGCCCACCTCAACCTCGAGGGATCA
GGCCGCGAGCTCGAGTCCATCGTCGTGGGTGAAATCCAGAAAGCTTACAATGCCTACGCCGGCATCCTGAAGCGC
GAGGCGGAAAATGCATACAATGCTGTCGAGGAGCTACGCCAGGGCCCCATAAACATGCCCAAGGATCAGGAGTGG
AACCACTTCGTAAAGCACGATGATCAGATCATCGATCCCAACATCCCCATGCGATCCGCCGACCAGATCCACTAT
CCGGGTCAGGATCACGTTGCCGCCTCGGAGATTCGCGCCGGCCTCCTGGAACGGAAGAGCAAGTATCTCAAGAGC
TACACGGCTGGCTGGTATGTACTTTCCGCCACTCATCTGCACGAGTTCAAGTCGGCGGACAAGGCCCAGGCCCCC
GTCATGTCGCTCTACTTGCCGGAGCAGAAGCTGGGCTCGCACTCGGCCGAGGGTGGAGCGTCCAACAAGTTCGTC
CTCAAGGGCCGCCAGACGGGTGCCATGCACCGAGGACACACCTGGGTCTTCCGAGCCGAGAGTCATGATACCATG
ATGGCCTGGTACGACGACATCCAGCTTGAGCCGATCGTCGCGCCGATCGGCCAGCAGCGACGGCATCGTCGACGA
GGACGACGAGGAGCCATTCGCGGCCAACCGGATCGACGTCGCCCCCGAACCGGCACCCCGACGGCCCGAACCAGT
GTAAATACGGGTCGCCAGGAGGAAACGTTGGACGCTCACGCCATCGCCGTCTCGGGAGCCGCGTACGCCGCCTCG
TCCGGCAGCGAGGAGCATGGACAGCAGGAGGACCATGGCCGCCGCCGTCAGCACCATCAAGGACACGGTGGAATG
GATGGGGGCATGCCGTCACAGGCAGCCGTTGCCGGCTACGAGGGACATGGCAGCGTCGTGAAGCCCGCAAATGGT
GACGTCGTTCAGAAGGGCGGCGGCAAGAGCCCTAATTCTGGCGGCTTGGCGAGGCCCTCGCTCAGCCCGACGAGC
GTGAAGGGAGAACGGCCAGTCAGCGACGACGACCGGGCGCGATACATGGACGAGCGCAAGATGATCGACGCCGAA
GTGGAGGCTCGAGGCGTCGACAGCAACAGCAGCGGTCTCCACGGCGCCTACTGCGTCAACGGCGGGGCCGTAACA
GATTTGACGTCGGCGGGAAGCGTCCCGAGGTCGGAGAAGCGGATGTCGCTGCCCGAGGCCCGCATCGTCGCCCAC
GCCATGGCCAAGGGCGAGGCGACGCCGCCGCCGTTGACGGAGCGGCCGGTGGCCGAGGTCCGGACGGACAGCGCG
GCGACGCTGTCGAACCTGCCGATGCCTGGCAGGTTTCCCCGCCGAGGCGGTGGAGTCTTGTCGTCGACGTGA
Gene >Ophio5|92
ATGGATCCTACTAGTAGTCTCGAATCGCGGGCGCCGCCGTCGCGTCAGGCGACTCAGACCCCGGAGCCCAATCTC
CACCAGCATCATCATCAGTCGCAAGCTGCCCACCAACAACAACAACAACAACAACAACAGACCCCACGAAGGCAA
CAGCAGAAGCAGAAGCCTCAGCCTTCTTCTCAACCTGAGCAGCAGTCTCAACAGCAGCCCTCTCAGAAACAACCC
CTGCTTCAGAAGCAGCAGCAGCAGCAGAACTCACCGCCAAGAGGCTCCCCCGCGCCCGACAGATTCAACGAGGAT
CGGGACGCCAACCAGCGCAGCATCTCCGTCGTCGACGGCCAGGTCAGGTCCAGGTCTACCTCGGCCATGCAGCGA
TCCGGCTCGCTTCGCAGTTTCGCCACTGGCGACGACCGCTCCCTACCCGTCCGGAGCAACACTTTGAGGAAGAGA
ACCTCGATGCGCCGCAGCAGCAGCCGCCGCAGTAACCGAGCCGGCAGCGTCCGCAGTCTCGCCGTCCAGACTGCT
CCGGACTCGGACGACGTCTCCAACGCCTTCTACTGCCCCGTGCCCACCTCCGGCACGCCTACCGACGTCCTCGCC
AATAGATTCCAAGGTATGATCATCATGGCCATCTTTTTTGTGCCGACTGTATGGCTAATCCAGGGCAGTATGGAG
AAAAATCCTCAAGGATGTCATCGCCTACTTTCGCGAGATACAGTCTCACTACGAGCAGCGAGCAAAGAGCCTCTT
CAAACTCGTTAACCTCGGAAACAACATCGCCACGCCTCCCAATTTCCTCAGCACTGGCGGCATCGACGACGCCCT
CCAGTTGCTACGCAAGCACAACCACGCGGCCCTGCAGGAGGCCAGCAAGGCCAAGGAGATTGAGGACGACGTCAT
TCTCGCTCTGACCGGACTCCGCAGCGATCTCCAGCAAAAGATCAAGGAGATCCGCCATCTTGCCGGCGATTTCAA
GAATTCGGTCGACCGCGAAATCGAGGGCACGCAAAAAGCGGTGCGCGCCCTCGCCGACGCCCTTGAGAAGACGGA
AATCGACTCAGCCTTCACCACCGGCAAGCAGGATCCCTACCTGCTGCGTCTCGCCGTCGACCAGCAGGTGGAGCG
CCAGATTGACGAAGAGAACTACCTCCACCAGGTGAGGCCATTAACTGGGATATTCCCGCGTGTGCCCACTGACGC
CTCCCGGCTGCAGGCCCACCTCAACCTCGAGGGATCAGGCCGCGAGCTCGAGTCCATCGTCGTGGGTGAAATCCA
GAAAGCTTACAATGCCTACGCCGGCATCCTGAAGCGCGAGGCGGAAAATGCATACAATGCTGTCGAGGAGCTACG
CCAGGGCCCCATAAACATGCCCAAGGATCAGGAGTGGAACCACTTCGTAAAGCACGATGATCAGATCATCGATCC
CAACATCCCCATGCGATCCGCCGACCAGATCCACTATCCGGGTCAGGATCACGTTGCCGCCTCGGAGATTCGCGC
CGGCCTCCTGGAACGGAAGAGCAAGTATCTCAAGAGCTACACGGCTGGCTGGTGAGTCTATCACAGAATCTCCTC
GGGGGGGGACGCGCGCTCTGGCTTGCTAACATGACAACTCCCCCGGTCAGGTATGTACTTTCCGCCACTCATCTG
CACGAGTTCAAGTCGGCGGACAAGGCCCAGGCCCCCGTCATGTCGCTCTACTTGCCGGAGCAGAAGCTGGGCTCG
CACTCGGCCGAGGGTGGAGCGTCCAACAAGTTCGTCCTCAAGGGCCGCCAGACGGGTGCCATGCACCGAGGACAC
ACCTGGGTCTTCCGAGCCGAGAGTCATGATACCATGATGGCCTGGTACGACGACATCCAGGTTCTCACGGAGAAG
ACGGCCGAGGAACGGTGCCAGTTCGTCCGCTCTCACTCGCGAAGCTTGAGCCGATCGTCGCGCCGATCGGCCAGC
AGCGACGGCATCGTCGACGAGGACGACGAGGAGCCATTCGCGGCCAACCGGATCGACGTCGCCCCCGAACCGGCA
CCCCGACGGCCCGAACCAGGTGGGCGGTTTCCATCCGACATACAGACCACTACGCAACGAGGCTCACAGGCGCCC
TCGTCTCCATCTAGTGTAAATACGGGTCGCCAGGAGGAAACGTTGGACGCTCACGCCATCGCCGTCTCGGGAGCC
GCGTACGCCGCCTCGTCCGGCAGCGAGGAGCATGGACAGCAGGAGGACCATGGCCGCCGCCGTCAGCACCATCAA
GGACACGGTGGAATGGATGGGGGCATGCCGTCACAGGCAGCCGTTGCCGGCTACGAGGGACATGGCAGCGTCGTG
AAGCCCGCAAATGGTGACGTCGTTCAGAAGGGCGGCGGCAAGAGCCCTAATTCTGGCGGCTTGGCGAGGCCCTCG
CTCAGCCCGACGAGCGTGAAGGGAGAACGGCCAGTCAGCGACGACGACCGGGCGCGATACATGGACGAGCGCAAG
ATGATCGACGCCGAAGTGGAGGCTCGAGGCGTCGACAGCAACAGCAGCGGTCTCCACGGCGCCTACTGCGTCAAC
GGCGGGGCCGTAACAGATTTGACGTCGGCGGGAAGCGTCCCGAGGTCGGAGAAGCGGATGTCGCTGCCCGAGGCC
CGCATCGTCGCCCACGCCATGGCCAAGGGCGAGGCGACGCCGCCGCCGTTGACGGAGCGGCCGGTGGCCGAGGTC
CGGACGGACAGCGCGGCGACGCTGTCGAACCTGCCGATGCCTGGCAGGTTTCCCCGCCGAGGCGGTGGAGTCTTG
TCGTCGACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail