Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|914
Gene name
Locationscaffold_127:38330..40194
Strand-
Gene length (bp)1864
Transcript length (bp)1695
Coding sequence length (bp)1692
Protein length (aa) 564

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01019 G_glu_transpept Gamma-glutamyltranspeptidase 8.6E-163 52 557

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B387|GGT1_ARTBC Gamma-glutamyltransferase ARB_02921 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02921 PE=1 SV=1 34 564 0.0E+00
sp|P19440|GGT1_HUMAN Gamma-glutamyltranspeptidase 1 OS=Homo sapiens GN=GGT1 PE=1 SV=2 35 556 5.0E-112
sp|P07314|GGT1_RAT Gamma-glutamyltranspeptidase 1 OS=Rattus norvegicus GN=Ggt1 PE=1 SV=4 17 556 4.0E-111
sp|P20735|GGT1_PIG Gamma-glutamyltranspeptidase 1 OS=Sus scrofa GN=GGT1 PE=2 SV=1 36 556 7.0E-111
sp|O14194|GGT2_SCHPO Gamma-glutamyltranspeptidase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ggt2 PE=2 SV=1 34 556 2.0E-108
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B387|GGT1_ARTBC Gamma-glutamyltransferase ARB_02921 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02921 PE=1 SV=1 34 564 0.0E+00
sp|P19440|GGT1_HUMAN Gamma-glutamyltranspeptidase 1 OS=Homo sapiens GN=GGT1 PE=1 SV=2 35 556 5.0E-112
sp|P07314|GGT1_RAT Gamma-glutamyltranspeptidase 1 OS=Rattus norvegicus GN=Ggt1 PE=1 SV=4 17 556 4.0E-111
sp|P20735|GGT1_PIG Gamma-glutamyltranspeptidase 1 OS=Sus scrofa GN=GGT1 PE=2 SV=1 36 556 7.0E-111
sp|O14194|GGT2_SCHPO Gamma-glutamyltranspeptidase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ggt2 PE=2 SV=1 34 556 2.0E-108
sp|Q60928|GGT1_MOUSE Gamma-glutamyltranspeptidase 1 OS=Mus musculus GN=Ggt1 PE=1 SV=1 17 556 1.0E-107
sp|Q9US04|GGT1_SCHPO Gamma-glutamyltranspeptidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ggt1 PE=2 SV=1 34 557 1.0E-105
sp|A6NGU5|GGT3_HUMAN Putative gamma-glutamyltranspeptidase 3 OS=Homo sapiens GN=GGT3P PE=5 SV=2 35 556 2.0E-103
sp|P36268|GGT2_HUMAN Inactive gamma-glutamyltranspeptidase 2 OS=Homo sapiens GN=GGT2 PE=1 SV=3 35 556 5.0E-101
sp|Q9M0G0|GAGT3_ARATH Gamma-glutamyltranspeptidase 3 OS=Arabidopsis thaliana GN=GGT3 PE=2 SV=1 37 533 1.0E-94
sp|P18956|GGT_ECOLI Gamma-glutamyltranspeptidase OS=Escherichia coli (strain K12) GN=ggt PE=1 SV=1 36 555 6.0E-92
sp|Q680I5|GAGT2_ARATH Gamma-glutamyltranspeptidase 2 OS=Arabidopsis thaliana GN=GGT2 PE=2 SV=1 37 504 6.0E-88
sp|Q8VYW6|GAGT1_ARATH Gamma-glutamyltranspeptidase 1 OS=Arabidopsis thaliana GN=GGT1 PE=2 SV=1 35 536 7.0E-88
sp|P36267|GGT_PSEUA Gamma-glutamyltranspeptidase OS=Pseudomonas sp. (strain A14) GN=ggt PE=1 SV=1 36 559 2.0E-77
sp|Q9I406|GGT_PSEAE Gamma-glutamyltranspeptidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ggt PE=3 SV=1 37 557 2.0E-68
sp|P54422|GGT_BACSU Gamma-glutamyltranspeptidase OS=Bacillus subtilis (strain 168) GN=ggt PE=1 SV=1 2 502 2.0E-66
sp|Q05902|ECM38_YEAST Gamma-glutamyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM38 PE=1 SV=1 34 522 4.0E-66
sp|P63186|GGT_BACNA Gamma-glutamyltranspeptidase OS=Bacillus subtilis subsp. natto GN=ggt PE=1 SV=1 2 502 6.0E-66
sp|Q9UJ14|GGT7_HUMAN Gamma-glutamyltransferase 7 OS=Homo sapiens GN=GGT7 PE=1 SV=2 36 564 9.0E-61
sp|Q99MZ4|GGT7_RAT Gamma-glutamyltransferase 7 OS=Rattus norvegicus GN=Ggt7 PE=1 SV=2 36 564 1.0E-60
sp|Q05053|PAC1_PSESV Acylase ACY 1 OS=Pseudomonas sp. (strain V22) GN=acyI PE=1 SV=2 34 551 1.0E-60
sp|P15557|PAC1_PSES3 Acylase ACY 1 OS=Pseudomonas sp. (strain SE83) GN=acyI PE=1 SV=2 34 551 3.0E-60
sp|Q99JP7|GGT7_MOUSE Gamma-glutamyltransferase 7 OS=Mus musculus GN=Ggt7 PE=1 SV=2 36 564 2.0E-59
sp|Q0V8L2|GGT7_BOVIN Gamma-glutamyltransferase 7 OS=Bos taurus GN=GGT7 PE=2 SV=1 36 564 8.0E-59
sp|Q9QWE9|GGT5_RAT Gamma-glutamyltransferase 5 OS=Rattus norvegicus GN=Ggt5 PE=2 SV=1 35 529 2.0E-57
sp|Q9Z2A9|GGT5_MOUSE Gamma-glutamyltransferase 5 OS=Mus musculus GN=Ggt5 PE=1 SV=2 35 498 9.0E-54
sp|P36269|GGT5_HUMAN Gamma-glutamyltransferase 5 OS=Homo sapiens GN=GGT5 PE=1 SV=2 46 543 2.0E-47
sp|Q9BX51|GGTL1_HUMAN Gamma-glutamyltransferase light chain 1 OS=Homo sapiens GN=GGTLC1 PE=2 SV=2 336 556 1.0E-44
sp|B5MD39|GGTL3_HUMAN Putative gamma-glutamyltransferase light chain 3 OS=Homo sapiens GN=GGTLC3 PE=5 SV=1 336 556 3.0E-41
sp|Q51693|CAPD_BACAN Capsule biosynthesis protein CapD OS=Bacillus anthracis GN=capD PE=1 SV=2 50 529 1.0E-39
sp|O05218|YWRD_BACSU Putative gamma-glutamyltransferase YwrD OS=Bacillus subtilis (strain 168) GN=ywrD PE=1 SV=1 34 555 3.0E-36
sp|Q14390|GGTL2_HUMAN Gamma-glutamyltransferase light chain 2 OS=Homo sapiens GN=GGTLC2 PE=2 SV=4 336 556 6.0E-35
sp|Q9CAR5|GAGT4_ARATH Putative inactive gamma-glutamyltranspeptidase 4 OS=Arabidopsis thaliana GN=GGT4 PE=5 SV=1 319 509 1.0E-31
sp|P74181|GGT_SYNY3 Gamma-glutamyltranspeptidase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ggt PE=3 SV=1 35 564 2.0E-30
sp|A7YWM1|GGT6_BOVIN Gamma-glutamyltransferase 6 OS=Bos taurus GN=GGT6 PE=2 SV=1 36 216 4.0E-17
sp|Q6IE08|GGT6_RAT Gamma-glutamyltransferase 6 OS=Rattus norvegicus GN=Ggt6 PE=2 SV=1 38 238 8.0E-14
sp|Q6PDE7|GGT6_MOUSE Gamma-glutamyltransferase 6 OS=Mus musculus GN=Ggt6 PE=2 SV=1 38 279 4.0E-12
sp|Q6P531|GGT6_HUMAN Gamma-glutamyltransferase 6 OS=Homo sapiens GN=GGT6 PE=2 SV=2 36 218 9.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 38.42 20.66 56.17
CcL In ants, during behavior modification 7.30 2.51 12.09
CcD In ants, recently dead 5.19 1.52 8.87

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.339571 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|914
MVLSTRRLASLLVAASLCHGVPVSVVLGPPANPGSRGAVVSEASECSHIGRDLLARGGNAADAVVGTTFCIGVVA
MYHSGIGGGGFALVRDADGGYDAVDFRETAPAAAHQDMFLGNVAGSMSGGLAVAVPGEVRGLEYIHRRYGSLPWE
TVLQGAIRVARDGFRVSSDLASKMSEKKRPYLRQDASFAIDFAPNGTLLGEGDLMTRKRYARTLERIAQEGSGAF
YGGEVAEAMVKQVQATNGTMTVDDLEHYTILSRPVQRVRYRGLDLYSVGAPASGVVGLNILKVAEQYVPGDADAG
LEAHRFVEAMRFGYGARARLADPDFIPGVKALEERLLDERYVRQVRRHIDDNRTLPVRDYDPTIHQYAPESHGTS
HVVTADAAGMAVSLTTTINLMFGAHLMEPQSGIVLNNEMNDFSIPGSPNDFGFPPSTANYIAPQKRPLSSIAPII
ASHPNGSLYAVVGAAGGSRIISATVAALWHLVEHGASMTDALRRPRMHDQLMPNVLLLEYAFDNVTAAALASRGH
NISRVGEGLSAVQGIRKRPDGSFEAAGEPRQRNSRGFAI
Coding >Ophio5|914
ATGGTCTTGTCCACGCGCCGGCTGGCGAGCCTCCTCGTCGCCGCCTCCCTCTGCCATGGCGTCCCCGTCTCTGTC
GTGCTTGGCCCGCCGGCGAACCCGGGCTCGCGGGGCGCCGTGGTCAGCGAGGCGTCTGAGTGTAGTCACATAGGC
AGAGACCTGCTTGCCCGAGGCGGAAACGCGGCGGATGCCGTCGTCGGCACAACCTTCTGCATTGGCGTCGTCGCC
ATGTATCATTCGGGCATTGGCGGAGGTGGCTTCGCCCTGGTGCGTGACGCCGATGGCGGCTATGATGCTGTCGAC
TTTAGAGAGACGGCTCCGGCGGCTGCTCACCAGGACATGTTTCTCGGTAACGTCGCCGGCAGCATGTCTGGCGGT
CTCGCTGTCGCCGTTCCAGGCGAGGTACGCGGTCTCGAATATATCCACCGCAGATACGGCTCGCTGCCGTGGGAG
ACGGTGCTACAAGGCGCCATCCGCGTCGCCCGTGACGGCTTTCGCGTCTCCAGCGACCTCGCCAGCAAAATGTCG
GAAAAGAAGCGTCCCTATCTGCGGCAAGACGCCAGCTTCGCCATCGACTTTGCGCCAAACGGCACCCTTCTCGGC
GAGGGAGACCTCATGACGCGAAAGCGCTACGCCAGGACGCTCGAGCGCATCGCCCAAGAGGGCTCCGGAGCCTTC
TACGGCGGCGAGGTCGCCGAGGCCATGGTCAAGCAGGTTCAGGCAACCAACGGGACCATGACAGTGGACGACCTC
GAGCACTACACCATTCTCTCCCGTCCCGTCCAGCGCGTCCGCTACCGCGGGCTGGATCTCTACTCCGTCGGCGCC
CCTGCCAGCGGCGTCGTTGGTCTCAACATCCTCAAGGTCGCCGAGCAGTACGTGCCCGGCGACGCAGATGCTGGC
CTCGAGGCCCACCGCTTCGTAGAGGCGATGCGCTTCGGGTACGGCGCGCGCGCGAGGCTCGCGGACCCGGATTTC
ATCCCTGGAGTGAAGGCGCTCGAGGAGCGGCTGCTGGATGAGAGGTACGTGCGTCAGGTGAGGCGGCACATCGAC
GACAATCGCACTTTGCCTGTTCGCGACTATGATCCGACGATTCATCAGTATGCGCCTGAGAGCCACGGCACGTCG
CATGTCGTTACCGCCGATGCGGCTGGCATGGCCGTCTCCCTCACCACCACCATCAACCTCATGTTCGGCGCGCAC
CTCATGGAGCCCCAGAGCGGAATCGTGCTAAACAACGAGATGAACGACTTCTCCATCCCCGGCTCCCCCAACGAC
TTCGGCTTTCCCCCCTCGACAGCAAACTACATCGCCCCTCAGAAGCGTCCCCTATCATCCATAGCGCCCATCATC
GCCTCCCACCCAAACGGCTCCCTCTACGCCGTCGTCGGAGCTGCCGGCGGCTCGCGCATCATCTCGGCCACCGTC
GCCGCGCTGTGGCACCTCGTCGAGCACGGTGCCTCCATGACGGATGCTCTGCGTCGCCCGCGCATGCACGATCAG
CTCATGCCCAATGTCCTTCTGCTCGAGTACGCCTTCGATAACGTCACGGCCGCCGCTCTGGCTTCCAGGGGCCAT
AATATCTCCCGCGTCGGCGAGGGACTCAGCGCCGTGCAGGGCATTCGCAAACGGCCCGACGGCTCCTTTGAGGCG
GCCGGTGAACCGCGACAGCGCAACAGTCGAGGCTTTGCCATT
Transcript >Ophio5|914
ATGGTCTTGTCCACGCGCCGGCTGGCGAGCCTCCTCGTCGCCGCCTCCCTCTGCCATGGCGTCCCCGTCTCTGTC
GTGCTTGGCCCGCCGGCGAACCCGGGCTCGCGGGGCGCCGTGGTCAGCGAGGCGTCTGAGTGTAGTCACATAGGC
AGAGACCTGCTTGCCCGAGGCGGAAACGCGGCGGATGCCGTCGTCGGCACAACCTTCTGCATTGGCGTCGTCGCC
ATGTATCATTCGGGCATTGGCGGAGGTGGCTTCGCCCTGGTGCGTGACGCCGATGGCGGCTATGATGCTGTCGAC
TTTAGAGAGACGGCTCCGGCGGCTGCTCACCAGGACATGTTTCTCGGTAACGTCGCCGGCAGCATGTCTGGCGGT
CTCGCTGTCGCCGTTCCAGGCGAGGTACGCGGTCTCGAATATATCCACCGCAGATACGGCTCGCTGCCGTGGGAG
ACGGTGCTACAAGGCGCCATCCGCGTCGCCCGTGACGGCTTTCGCGTCTCCAGCGACCTCGCCAGCAAAATGTCG
GAAAAGAAGCGTCCCTATCTGCGGCAAGACGCCAGCTTCGCCATCGACTTTGCGCCAAACGGCACCCTTCTCGGC
GAGGGAGACCTCATGACGCGAAAGCGCTACGCCAGGACGCTCGAGCGCATCGCCCAAGAGGGCTCCGGAGCCTTC
TACGGCGGCGAGGTCGCCGAGGCCATGGTCAAGCAGGTTCAGGCAACCAACGGGACCATGACAGTGGACGACCTC
GAGCACTACACCATTCTCTCCCGTCCCGTCCAGCGCGTCCGCTACCGCGGGCTGGATCTCTACTCCGTCGGCGCC
CCTGCCAGCGGCGTCGTTGGTCTCAACATCCTCAAGGTCGCCGAGCAGTACGTGCCCGGCGACGCAGATGCTGGC
CTCGAGGCCCACCGCTTCGTAGAGGCGATGCGCTTCGGGTACGGCGCGCGCGCGAGGCTCGCGGACCCGGATTTC
ATCCCTGGAGTGAAGGCGCTCGAGGAGCGGCTGCTGGATGAGAGGTACGTGCGTCAGGTGAGGCGGCACATCGAC
GACAATCGCACTTTGCCTGTTCGCGACTATGATCCGACGATTCATCAGTATGCGCCTGAGAGCCACGGCACGTCG
CATGTCGTTACCGCCGATGCGGCTGGCATGGCCGTCTCCCTCACCACCACCATCAACCTCATGTTCGGCGCGCAC
CTCATGGAGCCCCAGAGCGGAATCGTGCTAAACAACGAGATGAACGACTTCTCCATCCCCGGCTCCCCCAACGAC
TTCGGCTTTCCCCCCTCGACAGCAAACTACATCGCCCCTCAGAAGCGTCCCCTATCATCCATAGCGCCCATCATC
GCCTCCCACCCAAACGGCTCCCTCTACGCCGTCGTCGGAGCTGCCGGCGGCTCGCGCATCATCTCGGCCACCGTC
GCCGCGCTGTGGCACCTCGTCGAGCACGGTGCCTCCATGACGGATGCTCTGCGTCGCCCGCGCATGCACGATCAG
CTCATGCCCAATGTCCTTCTGCTCGAGTACGCCTTCGATAACGTCACGGCCGCCGCTCTGGCTTCCAGGGGCCAT
AATATCTCCCGCGTCGGCGAGGGACTCAGCGCCGTGCAGGGCATTCGCAAACGGCCCGACGGCTCCTTTGAGGCG
GCCGGTGAACCGCGACAGCGCAACAGTCGAGGCTTTGCCATTTAA
Gene >Ophio5|914
ATGGGTGCGTATGATACACTCATCCCGTCTTGCCCCTTGCTGATTGCCTACGCCTCTCACCCCCAGTCTTGTCCA
CGCGCCGGCTGGCGAGCCTCCTCGTCGCCGCCTCCCTCTGCCATGGCGTCCCCGTCTCTGTCGTGCTTGGCCCGC
CGGCGAACCCGGGCTCGCGGGGCGCCGTGGTCAGCGAGGCGTCTGAGTGTAGTCACATAGGCAGAGACCTGCTTG
CCCGAGGCGTGCGTCTTCCGTCCATTGTCGACTCTCACTCTACTGACTCTATGACTAGGGAAACGCGGCGGATGC
CGTCGTCGGCACAACCTTCTGCATTGGCGTCGTCGCCATGTATCATTCGGGCATTGGCGGAGGTGGCTTCGCCCT
GGTGCGTGACGCCGATGGCGGCTATGATGCTGTCGACTTTAGAGAGACGGCTCCGGCGGCTGCTCACCAGGACAT
GTTTCTCGGTAACGTCGCCGGCAGCATGTCTGGCGGTCTCGCTGTCGCCGTTCCAGGCGAGGTACGCGGTCTCGA
ATATATCCACCGCAGATACGGCTCGCTGCCGTGGGAGACGGTGCTACAAGGCGCCATCCGCGTCGCCCGTGACGG
CTTTCGCGTCTCCAGCGACCTCGCCAGCAAAATGTCGGAAAAGAAGCGTCCCTATCTGCGGCAAGACGCCAGCTT
CGCCATCGACTTTGCGCCAAACGGCACCCTTCTCGGCGAGGGAGACCTCATGACGCGAAAGCGCTACGCCAGGAC
GCTCGAGCGCATCGCCCAAGAGGGCTCCGGAGCCTTCTACGGCGGCGAGGTCGCCGAGGCCATGGTCAAGCAGGT
TCAGGCAACCAACGGGACCATGACAGTGGACGACCTCGAGCACTACACCATTCTCTCCCGTCCCGTCCAGCGCGT
CCGCTACCGCGGGCTGGATCTCTACTCCGTCGGCGCCCCTGCCAGCGGCGTCGTTGGTCTCAACATCCTCAAGGT
CGCCGAGCAGTACGTGCCCGGCGACGCAGATGCTGGCCTCGAGGCCCACCGCTTCGTAGAGGCGATGCGCTTCGG
GTACGGCGCGCGCGCGAGGCTCGCGGACCCGGATTTCATCCCTGGAGTGAAGGCGCTCGAGGAGCGGCTGCTGGA
TGAGAGGTACGTGCGTCAGGTGAGGCGGCACATCGACGACAATCGCACTTTGCCTGTTCGCGACTATGATCCGAC
GATTCATCAGTATGCGCCTGAGAGCCACGGCACGTCGCATGTCGTTACCGCCGATGCGGCTGGCATGGCCGTCTC
CCTCACCACCACCATCAACCTCATGTTCGGCGCGCACCTCATGGAGCCCCAGAGCGGAATCGTGCTGTACGTTCT
CCCATTCATTCTTCACTTCCTCTCCCCCACAGCTTCTCATGCCAGCAGAAACAACGAGATGAACGACTTCTCCAT
CCCCGGCTCCCCCAACGACTTCGGCTTTCCCCCCTCGACAGCAAACTACATCGCCCCTCAGAAGCGTCCCCTATC
ATCCATAGCGCCCATCATCGCCTCCCACCCAAACGGCTCCCTCTACGCCGTCGTCGGAGCTGCCGGCGGCTCGCG
CATCATCTCGGCCACCGTCGCCGCGCTGTGGCACCTCGTCGAGCACGGTGCCTCCATGACGGATGCTCTGCGTCG
CCCGCGCATGCACGATCAGCTCATGCCCAATGTCCTTCTGCTCGAGTACGCCTTCGATAACGTCACGGCCGCCGC
TCTGGCTTCCAGGGGCCATAATATCTCCCGCGTCGGCGAGGGACTCAGCGCCGTGCAGGGCATTCGCAAACGGCC
CGACGGCTCCTTTGAGGCGGCCGGTGAACCGCGACAGCGCAACAGTCGAGGCTTTGCCATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail