Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|912
Gene name
Locationscaffold_127:34830..35832
Strand-
Gene length (bp)1002
Transcript length (bp)1002
Coding sequence length (bp)999
Protein length (aa) 333

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q3SYV3|OXA1L_BOVIN Mitochondrial inner membrane protein OXA1L OS=Bos taurus GN=OXA1L PE=2 SV=1 53 305 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 33 55 22
2 59 81 22
3 251 273 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|912
MRPPHRTLTGLYPLARVRARQPSIRTQTDGRRHSHFGLVIASTADAISSLHAIGLPWYLVIPLVAAGVNFSIRLP
IHLYVSNLNRTRRELRPLLAAWHARHMGSGTQGLEAVAAPNFESRVAALNKKSRDRIFKEWRVQQWKSFMPILSV
GPFLVVSQALRALCGAPSMASSDIDTASGLFHQSLADGGCLWFVDLTAQDPYYALPLLCTALIAKNIWGRLSKDD
FREVFALNDTRPKSPMHRLKLGVTRIMLFFPLVAAASAYLPSAVFLYWTTTFGLGSVNSAIATWRAPKIEAGSEI
SLPQKPPRIHANLPYLRGPDTGSRRELKSSAAS
Coding >Ophio5|912
ATGCGGCCGCCTCACAGAACTCTCACAGGCCTCTATCCCCTTGCCAGAGTCCGTGCCCGGCAGCCATCGATCCGA
ACCCAGACAGATGGGCGACGACACTCTCATTTCGGGCTTGTCATCGCGTCAACTGCAGACGCAATAAGCTCTCTT
CACGCCATTGGCTTGCCCTGGTATCTCGTTATCCCGCTGGTGGCTGCGGGAGTCAATTTCTCCATCCGGCTCCCC
ATCCACCTCTACGTCTCCAACTTGAACCGGACAAGACGAGAGCTGAGGCCCTTACTTGCGGCATGGCATGCGCGG
CACATGGGCTCCGGTACGCAAGGCCTTGAAGCGGTCGCGGCGCCCAACTTCGAGAGCCGTGTCGCCGCTCTCAAC
AAGAAGTCGCGGGACCGAATCTTCAAGGAATGGCGTGTCCAACAATGGAAATCCTTTATGCCGATTCTCAGCGTC
GGCCCTTTTCTCGTCGTCTCCCAAGCTTTACGGGCTTTGTGTGGCGCGCCATCGATGGCATCGTCGGATATAGAC
ACCGCCAGCGGCCTCTTCCATCAGTCCCTTGCTGACGGAGGCTGTCTATGGTTCGTCGACTTGACCGCCCAGGAT
CCTTACTATGCCCTTCCTCTACTATGCACCGCTCTTATTGCAAAAAATATATGGGGAAGACTATCCAAGGATGAC
TTTCGAGAAGTCTTCGCTTTGAACGACACTAGGCCCAAGTCTCCCATGCATAGGCTGAAACTAGGCGTGACCCGG
ATAATGTTGTTCTTTCCTTTGGTCGCCGCCGCTTCCGCCTATCTGCCCTCCGCTGTCTTTCTGTATTGGACCACG
ACTTTTGGCCTCGGCAGCGTCAACTCGGCTATTGCAACGTGGCGCGCTCCCAAGATAGAAGCAGGTTCGGAAATA
AGTCTGCCACAGAAGCCCCCGAGAATCCATGCAAACTTGCCATATCTGCGAGGGCCGGATACGGGATCGAGGCGG
GAACTAAAGTCATCAGCAGCATCA
Transcript >Ophio5|912
ATGCGGCCGCCTCACAGAACTCTCACAGGCCTCTATCCCCTTGCCAGAGTCCGTGCCCGGCAGCCATCGATCCGA
ACCCAGACAGATGGGCGACGACACTCTCATTTCGGGCTTGTCATCGCGTCAACTGCAGACGCAATAAGCTCTCTT
CACGCCATTGGCTTGCCCTGGTATCTCGTTATCCCGCTGGTGGCTGCGGGAGTCAATTTCTCCATCCGGCTCCCC
ATCCACCTCTACGTCTCCAACTTGAACCGGACAAGACGAGAGCTGAGGCCCTTACTTGCGGCATGGCATGCGCGG
CACATGGGCTCCGGTACGCAAGGCCTTGAAGCGGTCGCGGCGCCCAACTTCGAGAGCCGTGTCGCCGCTCTCAAC
AAGAAGTCGCGGGACCGAATCTTCAAGGAATGGCGTGTCCAACAATGGAAATCCTTTATGCCGATTCTCAGCGTC
GGCCCTTTTCTCGTCGTCTCCCAAGCTTTACGGGCTTTGTGTGGCGCGCCATCGATGGCATCGTCGGATATAGAC
ACCGCCAGCGGCCTCTTCCATCAGTCCCTTGCTGACGGAGGCTGTCTATGGTTCGTCGACTTGACCGCCCAGGAT
CCTTACTATGCCCTTCCTCTACTATGCACCGCTCTTATTGCAAAAAATATATGGGGAAGACTATCCAAGGATGAC
TTTCGAGAAGTCTTCGCTTTGAACGACACTAGGCCCAAGTCTCCCATGCATAGGCTGAAACTAGGCGTGACCCGG
ATAATGTTGTTCTTTCCTTTGGTCGCCGCCGCTTCCGCCTATCTGCCCTCCGCTGTCTTTCTGTATTGGACCACG
ACTTTTGGCCTCGGCAGCGTCAACTCGGCTATTGCAACGTGGCGCGCTCCCAAGATAGAAGCAGGTTCGGAAATA
AGTCTGCCACAGAAGCCCCCGAGAATCCATGCAAACTTGCCATATCTGCGAGGGCCGGATACGGGATCGAGGCGG
GAACTAAAGTCATCAGCAGCATCATAA
Gene >Ophio5|912
ATGCGGCCGCCTCACAGAACTCTCACAGGCCTCTATCCCCTTGCCAGAGTCCGTGCCCGGCAGCCATCGATCCGA
ACCCAGACAGATGGGCGACGACACTCTCATTTCGGGCTTGTCATCGCGTCAACTGCAGACGCAATAAGCTCTCTT
CACGCCATTGGCTTGCCCTGGTATCTCGTTATCCCGCTGGTGGCTGCGGGAGTCAATTTCTCCATCCGGCTCCCC
ATCCACCTCTACGTCTCCAACTTGAACCGGACAAGACGAGAGCTGAGGCCCTTACTTGCGGCATGGCATGCGCGG
CACATGGGCTCCGGTACGCAAGGCCTTGAAGCGGTCGCGGCGCCCAACTTCGAGAGCCGTGTCGCCGCTCTCAAC
AAGAAGTCGCGGGACCGAATCTTCAAGGAATGGCGTGTCCAACAATGGAAATCCTTTATGCCGATTCTCAGCGTC
GGCCCTTTTCTCGTCGTCTCCCAAGCTTTACGGGCTTTGTGTGGCGCGCCATCGATGGCATCGTCGGATATAGAC
ACCGCCAGCGGCCTCTTCCATCAGTCCCTTGCTGACGGAGGCTGTCTATGGTTCGTCGACTTGACCGCCCAGGAT
CCTTACTATGCCCTTCCTCTACTATGCACCGCTCTTATTGCAAAAAATATATGGGGAAGACTATCCAAGGATGAC
TTTCGAGAAGTCTTCGCTTTGAACGACACTAGGCCCAAGTCTCCCATGCATAGGCTGAAACTAGGCGTGACCCGG
ATAATGTTGTTCTTTCCTTTGGTCGCCGCCGCTTCCGCCTATCTGCCCTCCGCTGTCTTTCTGTATTGGACCACG
ACTTTTGGCCTCGGCAGCGTCAACTCGGCTATTGCAACGTGGCGCGCTCCCAAGATAGAAGCAGGTTCGGAAATA
AGTCTGCCACAGAAGCCCCCGAGAATCCATGCAAACTTGCCATATCTGCGAGGGCCGGATACGGGATCGAGGCGG
GAACTAAAGTCATCAGCAGCATCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail