Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|910
Gene name
Locationscaffold_127:31307..33484
Strand-
Gene length (bp)2177
Transcript length (bp)1983
Coding sequence length (bp)1980
Protein length (aa) 660

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09531 Ndc1_Nup Nucleoporin protein Ndc1-Nup 1.9E-112 17 349
PF09531 Ndc1_Nup Nucleoporin protein Ndc1-Nup 2.4E-49 351 591

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G0S235|NDC1_CHATD Nucleoporin NDC1 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NDC1 PE=3 SV=1 7 595 1.0E-137
sp|O13961|NDC1_SCHPO Nuclear envelope protein ndc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut11 PE=2 SV=2 11 583 2.0E-21

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22
2 61 83 22
3 106 128 22
4 212 234 22
5 268 290 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 62.15 33.81 90.50
CcL In ants, during behavior modification 116.33 55.39 177.26
CcD In ants, recently dead 134.01 67.89 200.12

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.009031 yes
SC16a CcD 0.000286 yes
CcL CcD 0.622401 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|910
MAVTPSRRAPYKDTLQPALHRRFSSTATLLLAASYLEALLLAPWTSFFWSWFPFGPCGIRTALIFACGLAILVLR
IANYHVGFRTTTSGLQSLGSILASPRSYETGFWYGFSALLFCPVFLASMPGSANLQWITYLSGDRARLNERPLML
ACHLIMCALWQTIRHYWLDIDHLDLGTMKPKAEDRGTDSTPPSGSLHAIVSQVPRVLSECAFQAGLSLPFTVGFY
FVCLRSFVWGWAMTFLRPFYSLPQTRMPPQSWPIDLFLMARCVYAGTLLFVVWSTGNMAFSVFMVKEPLKNGKPL
TSESKDPNGSLLNGLKSKKPSIQAFAMWELALIAKDFDARRQAIYRDIDQLRVDQYGKPDTSAVVQTTEPSVRPR
VSGPLRDEPILTQTNRAYGLAGGVEKAWDQIGRAPGASPVSELSPLAKKTWKEAKDRLLSKEQQEVLSPDHIRSG
LEHWAAGLVEVRWLGSLLRQDSGTRLTATILGTPYAEPTLYINAVEALCQLAVHSLSEDEFGIVQRDVASIVRTM
TAVMDKVEALKRRFPSHWMDPRRVPRSPAVDAVTEALRTGLERLMTTFEPYSRDLGLSRGDVRLAKEAAATPLDL
APVTKSTARGIEKKKTTTTTITSKARRAQEKNREKDREKDRKKDREWERAPRGLEMEQVQ
Coding >Ophio5|910
ATGGCCGTCACACCGAGCCGCAGAGCTCCTTACAAGGACACGCTACAGCCCGCCTTGCATAGACGCTTCTCCTCA
ACGGCCACGCTCCTGCTAGCCGCGTCGTACCTCGAGGCTCTGCTCCTGGCGCCGTGGACTTCCTTCTTCTGGTCG
TGGTTTCCCTTTGGGCCTTGCGGCATCCGCACAGCTCTCATCTTTGCCTGTGGACTCGCGATCCTCGTCCTCCGC
ATCGCAAACTACCATGTCGGTTTCAGGACGACGACCTCGGGGCTGCAATCGCTCGGTTCAATACTGGCAAGCCCC
CGGTCGTACGAGACGGGCTTCTGGTACGGCTTTTCGGCCCTACTCTTTTGCCCCGTCTTCCTGGCTTCCATGCCC
GGCTCGGCCAACCTGCAATGGATCACGTACTTGAGCGGCGACCGTGCCCGGCTCAACGAGCGGCCTCTGATGTTG
GCTTGTCATCTGATAATGTGCGCGCTGTGGCAGACTATTCGCCACTACTGGCTCGATATAGATCATCTCGATCTT
GGGACGATGAAGCCGAAAGCAGAGGATCGAGGGACAGACTCGACCCCGCCGTCGGGGTCTCTTCACGCGATTGTG
TCCCAGGTCCCCAGGGTCCTCTCGGAATGCGCGTTCCAAGCGGGGCTCTCTTTGCCCTTTACCGTTGGTTTCTAT
TTTGTTTGCCTGAGATCCTTTGTCTGGGGATGGGCTATGACGTTTCTGCGGCCGTTCTACAGCCTTCCCCAGACG
AGGATGCCCCCGCAGTCATGGCCTATCGACCTCTTTCTCATGGCACGCTGCGTCTACGCCGGGACGCTCCTGTTT
GTTGTGTGGTCCACGGGGAATATGGCATTTTCGGTCTTCATGGTCAAAGAGCCCCTGAAGAACGGGAAGCCTCTG
ACGTCGGAATCAAAGGACCCTAACGGGAGTCTTTTGAACGGGCTAAAGAGCAAGAAACCGTCTATCCAGGCATTC
GCTATGTGGGAGTTGGCGCTCATTGCCAAGGATTTTGATGCGCGCAGACAGGCCATATACCGCGACATCGACCAG
TTGCGTGTGGACCAGTACGGGAAGCCTGACACGTCGGCCGTCGTACAGACCACAGAGCCTTCAGTCAGGCCACGG
GTATCGGGGCCGCTGCGGGATGAGCCGATCCTCACTCAGACCAATCGGGCCTACGGGCTGGCTGGGGGCGTTGAA
AAGGCATGGGATCAAATTGGTCGAGCCCCCGGCGCTTCCCCGGTCTCGGAGCTGAGCCCGCTTGCGAAAAAGACG
TGGAAGGAGGCCAAGGACCGGCTTCTGAGCAAGGAGCAGCAGGAGGTGCTCTCGCCGGACCACATCAGGAGCGGA
CTGGAGCATTGGGCAGCCGGCTTGGTCGAGGTCCGGTGGCTCGGGAGCCTGCTACGGCAGGACTCGGGCACGCGG
CTGACGGCGACGATACTGGGCACGCCATATGCGGAGCCGACGCTCTACATCAACGCCGTGGAGGCGCTCTGTCAG
CTTGCAGTGCACAGCCTCTCGGAAGACGAGTTTGGCATCGTGCAGCGGGATGTGGCGAGTATCGTGCGGACGATG
ACGGCGGTGATGGACAAGGTGGAAGCTCTCAAGCGGCGATTCCCGAGTCATTGGATGGACCCTCGGAGGGTGCCT
CGGAGCCCCGCCGTGGACGCGGTCACGGAGGCGCTGCGCACGGGACTGGAGCGGCTAATGACGACGTTTGAGCCC
TACAGCCGCGACTTGGGCTTGTCACGAGGAGACGTCCGGCTGGCCAAGGAGGCGGCGGCGACGCCTCTAGATTTG
GCGCCTGTGACGAAAAGCACGGCCAGGGGCATCGAGAAGAAGAAGACGACGACGACGACGATTACGTCCAAGGCT
AGACGGGCGCAGGAGAAGAACCGGGAGAAGGACCGGGAGAAGGACCGGAAGAAGGACCGGGAGTGGGAGAGGGCG
CCGCGCGGCTTGGAGATGGAACAGGTGCAA
Transcript >Ophio5|910
ATGGCCGTCACACCGAGCCGCAGAGCTCCTTACAAGGACACGCTACAGCCCGCCTTGCATAGACGCTTCTCCTCA
ACGGCCACGCTCCTGCTAGCCGCGTCGTACCTCGAGGCTCTGCTCCTGGCGCCGTGGACTTCCTTCTTCTGGTCG
TGGTTTCCCTTTGGGCCTTGCGGCATCCGCACAGCTCTCATCTTTGCCTGTGGACTCGCGATCCTCGTCCTCCGC
ATCGCAAACTACCATGTCGGTTTCAGGACGACGACCTCGGGGCTGCAATCGCTCGGTTCAATACTGGCAAGCCCC
CGGTCGTACGAGACGGGCTTCTGGTACGGCTTTTCGGCCCTACTCTTTTGCCCCGTCTTCCTGGCTTCCATGCCC
GGCTCGGCCAACCTGCAATGGATCACGTACTTGAGCGGCGACCGTGCCCGGCTCAACGAGCGGCCTCTGATGTTG
GCTTGTCATCTGATAATGTGCGCGCTGTGGCAGACTATTCGCCACTACTGGCTCGATATAGATCATCTCGATCTT
GGGACGATGAAGCCGAAAGCAGAGGATCGAGGGACAGACTCGACCCCGCCGTCGGGGTCTCTTCACGCGATTGTG
TCCCAGGTCCCCAGGGTCCTCTCGGAATGCGCGTTCCAAGCGGGGCTCTCTTTGCCCTTTACCGTTGGTTTCTAT
TTTGTTTGCCTGAGATCCTTTGTCTGGGGATGGGCTATGACGTTTCTGCGGCCGTTCTACAGCCTTCCCCAGACG
AGGATGCCCCCGCAGTCATGGCCTATCGACCTCTTTCTCATGGCACGCTGCGTCTACGCCGGGACGCTCCTGTTT
GTTGTGTGGTCCACGGGGAATATGGCATTTTCGGTCTTCATGGTCAAAGAGCCCCTGAAGAACGGGAAGCCTCTG
ACGTCGGAATCAAAGGACCCTAACGGGAGTCTTTTGAACGGGCTAAAGAGCAAGAAACCGTCTATCCAGGCATTC
GCTATGTGGGAGTTGGCGCTCATTGCCAAGGATTTTGATGCGCGCAGACAGGCCATATACCGCGACATCGACCAG
TTGCGTGTGGACCAGTACGGGAAGCCTGACACGTCGGCCGTCGTACAGACCACAGAGCCTTCAGTCAGGCCACGG
GTATCGGGGCCGCTGCGGGATGAGCCGATCCTCACTCAGACCAATCGGGCCTACGGGCTGGCTGGGGGCGTTGAA
AAGGCATGGGATCAAATTGGTCGAGCCCCCGGCGCTTCCCCGGTCTCGGAGCTGAGCCCGCTTGCGAAAAAGACG
TGGAAGGAGGCCAAGGACCGGCTTCTGAGCAAGGAGCAGCAGGAGGTGCTCTCGCCGGACCACATCAGGAGCGGA
CTGGAGCATTGGGCAGCCGGCTTGGTCGAGGTCCGGTGGCTCGGGAGCCTGCTACGGCAGGACTCGGGCACGCGG
CTGACGGCGACGATACTGGGCACGCCATATGCGGAGCCGACGCTCTACATCAACGCCGTGGAGGCGCTCTGTCAG
CTTGCAGTGCACAGCCTCTCGGAAGACGAGTTTGGCATCGTGCAGCGGGATGTGGCGAGTATCGTGCGGACGATG
ACGGCGGTGATGGACAAGGTGGAAGCTCTCAAGCGGCGATTCCCGAGTCATTGGATGGACCCTCGGAGGGTGCCT
CGGAGCCCCGCCGTGGACGCGGTCACGGAGGCGCTGCGCACGGGACTGGAGCGGCTAATGACGACGTTTGAGCCC
TACAGCCGCGACTTGGGCTTGTCACGAGGAGACGTCCGGCTGGCCAAGGAGGCGGCGGCGACGCCTCTAGATTTG
GCGCCTGTGACGAAAAGCACGGCCAGGGGCATCGAGAAGAAGAAGACGACGACGACGACGATTACGTCCAAGGCT
AGACGGGCGCAGGAGAAGAACCGGGAGAAGGACCGGGAGAAGGACCGGAAGAAGGACCGGGAGTGGGAGAGGGCG
CCGCGCGGCTTGGAGATGGAACAGGTGCAATAG
Gene >Ophio5|910
ATGGCCGTCACACCGAGCCGCAGAGCTCCTTACAAGGACACGCTACAGCCCGCCTTGCATAGACGCTTCTCCTCA
ACGGCCACGCTCCTGCTAGCCGCGTCGTACCTCGAGGCTCTGCTCCTGGCGCCGTGGACTTCCTGTGAGTGCAAA
AAGCGCCTTTTTACCCTTTCTCACTCGGCCGATTCGACTTTGTGAAGCTGACGGTGCGCAGTCTTCTGGTCGTGG
TTTCCCTTTGGGCCTTGCGGCATCCGCACAGCTCTCATCTTTGCCTGTGGACTCGCGATCCTCGTCCTCCGCATC
GCAAACTACCATGTCGGTTTCAGGACGACGACCTCGGGGCTGCAATCGCTCGGTTCAATACTGGCAAGCCCCCGG
TCGTACGAGACGGGCTTCTGGTACGGCTTTTCGGCCCTACTCTTTTGCCCCGTCTTCCTGGCTTCCATGCCCGGC
TCGGCCAACCTGCAATGGATCACGTACTTGAGCGGCGACCGTGCCCGGCTCAACGAGCGGCCTCTGATGTTGGCT
TGTCATCTGATAATGTGCGCGCTGTGGCAGACTATTCGCCACTACTGGCTCGATATAGATCATCTCGATCTTGGG
ACGATGAAGCCGAAAGCAGAGGATCGAGGGACAGACTCGACCCCGCCGTCGGGGTCTCTTCACGCGATTGTGTCC
CAGGTCCCCAGGGTCCTCTCGGAATGCGCGTTCCAAGCGGGGCTCTCTTTGCCCTTTACCGTTGGTTTCTATTTT
GTTTGCCTGAGATCCTTTGTCTGGGGATGGGCTATGACGTTTCTGCGGCCGTTCTACAGCCTTCCCCAGACGAGG
ATGCCCCCGCAGTCATGGCCTATCGACCTCTTTCTCATGGCACGCTGCGTCTACGCCGGGACGCTCCTGTTTGTT
GTGTGGTCCACGGGGAATATGGCATTTTCGGTCTTCATGGTCAAAGAGCCCCTGAAGAACGGGAAGCCTCTGACG
TCGGAATCAAAGGACCCTAACGGGAGTCTTTTGAACGGGCTAAAGAGCAAGAAACCGTCTATCCAGGCAAGTGTA
GCCCGCTGCGTCGTCGCGACTCGAGTTGTCTCCCGCTAAACGGACATTAGGCATTCGCTATGTGGGAGTTGGCGC
TCATTGCCAAGGATTTTGATGCGCGCAGACAGGCCATATACCGCGACATCGACCGTAAGGATGGCCCCATGTGGA
CGCAGATTTGCGCCATCTGCATGGAAGTGCTGAAGAGCATAGAGTTGCGTGTGGACCAGTACGGGAAGCCTGACA
CGTCGGCCGTCGTACAGACCACAGAGCCTTCAGTCAGGCCACGGGTATCGGGGCCGCTGCGGGATGAGCCGATCC
TCACTCAGACCAATCGGGCCTACGGGCTGGCTGGGGGCGTTGAAAAGGCATGGGATCAAATTGGTCGAGCCCCCG
GCGCTTCCCCGGTCTCGGAGCTGAGCCCGCTTGCGAAAAAGACGTGGAAGGAGGCCAAGGACCGGCTTCTGAGCA
AGGAGCAGCAGGAGGTGCTCTCGCCGGACCACATCAGGAGCGGACTGGAGCATTGGGCAGCCGGCTTGGTCGAGG
TCCGGTGGCTCGGGAGCCTGCTACGGCAGGACTCGGGCACGCGGCTGACGGCGACGATACTGGGCACGCCATATG
CGGAGCCGACGCTCTACATCAACGCCGTGGAGGCGCTCTGTCAGCTTGCAGTGCACAGCCTCTCGGAAGACGAGT
TTGGCATCGTGCAGCGGGATGTGGCGAGTATCGTGCGGACGATGACGGCGGTGATGGACAAGGTGGAAGCTCTCA
AGCGGCGATTCCCGAGTCATTGGATGGACCCTCGGAGGGTGCCTCGGAGCCCCGCCGTGGACGCGGTCACGGAGG
CGCTGCGCACGGGACTGGAGCGGCTAATGACGACGTTTGAGCCCTACAGCCGCGACTTGGGCTTGTCACGAGGAG
ACGTCCGGCTGGCCAAGGAGGCGGCGGCGACGCCTCTAGATTTGGCGCCTGTGACGAAAAGCACGGCCAGGGGCA
TCGAGAAGAAGAAGACGACGACGACGACGATTACGTCCAAGGCTAGACGGGCGCAGGAGAAGAACCGGGAGAAGG
ACCGGGAGAAGGACCGGAAGAAGGACCGGGAGTGGGAGAGGGCGCCGCGCGGCTTGGAGATGGAACAGGTGCAAT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail