Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|910
Gene name
Locationscaffold_127:31307..33484
Strand-
Gene length (bp)2177
Transcript length (bp)1983
Coding sequence length (bp)1980
Protein length (aa) 660

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09531 Ndc1_Nup Nucleoporin protein Ndc1-Nup 1.9E-112 17 349
PF09531 Ndc1_Nup Nucleoporin protein Ndc1-Nup 2.4E-49 351 591

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G0S235|NDC1_CHATD Nucleoporin NDC1 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NDC1 PE=3 SV=1 7 595 1.0E-137
sp|O13961|NDC1_SCHPO Nuclear envelope protein ndc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut11 PE=2 SV=2 11 583 2.0E-21

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22
2 61 83 22
3 106 128 22
4 212 234 22
5 268 290 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|910
MAVTPSRRAPYKDTLQPALHRRFSSTATLLLAASYLEALLLAPWTSFFWSWFPFGPCGIRTALIFACGLAILVLR
IANYHVGFRTTTSGLQSLGSILASPRSYETGFWYGFSALLFCPVFLASMPGSANLQWITYLSGDRARLNERPLML
ACHLIMCALWQTIRHYWLDIDHLDLGTMKPKAEDRGTDSTPPSGSLHAIVSQVPRVLSECAFQAGLSLPFTVGFY
FVCLRSFVWGWAMTFLRPFYSLPQTRMPPQSWPIDLFLMARCVYAGTLLFVVWSTGNMAFSVFMVKEPLKNGKPL
TSESKDPNGSLLNGLKSKKPSIQAFAMWELALIAKDFDARRQAIYRDIDQLRVDQYGKPDTSAVVQTTEPSVRPR
VSGPLRDEPILTQTNRAYGLAGGVEKAWDQIGRAPGASPVSELSPLAKKTWKEAKDRLLSKEQQEVLSPDHIRSG
LEHWAAGLVEVRWLGSLLRQDSGTRLTATILGTPYAEPTLYINAVEALCQLAVHSLSEDEFGIVQRDVASIVRTM
TAVMDKVEALKRRFPSHWMDPRRVPRSPAVDAVTEALRTGLERLMTTFEPYSRDLGLSRGDVRLAKEAAATPLDL
APVTKSTARGIEKKKTTTTTITSKARRAQEKNREKDREKDRKKDREWERAPRGLEMEQVQ
Coding >Ophio5|910
ATGGCCGTCACACCGAGCCGCAGAGCTCCTTACAAGGACACGCTACAGCCCGCCTTGCATAGACGCTTCTCCTCA
ACGGCCACGCTCCTGCTAGCCGCGTCGTACCTCGAGGCTCTGCTCCTGGCGCCGTGGACTTCCTTCTTCTGGTCG
TGGTTTCCCTTTGGGCCTTGCGGCATCCGCACAGCTCTCATCTTTGCCTGTGGACTCGCGATCCTCGTCCTCCGC
ATCGCAAACTACCATGTCGGTTTCAGGACGACGACCTCGGGGCTGCAATCGCTCGGTTCAATACTGGCAAGCCCC
CGGTCGTACGAGACGGGCTTCTGGTACGGCTTTTCGGCCCTACTCTTTTGCCCCGTCTTCCTGGCTTCCATGCCC
GGCTCGGCCAACCTGCAATGGATCACGTACTTGAGCGGCGACCGTGCCCGGCTCAACGAGCGGCCTCTGATGTTG
GCTTGTCATCTGATAATGTGCGCGCTGTGGCAGACTATTCGCCACTACTGGCTCGATATAGATCATCTCGATCTT
GGGACGATGAAGCCGAAAGCAGAGGATCGAGGGACAGACTCGACCCCGCCGTCGGGGTCTCTTCACGCGATTGTG
TCCCAGGTCCCCAGGGTCCTCTCGGAATGCGCGTTCCAAGCGGGGCTCTCTTTGCCCTTTACCGTTGGTTTCTAT
TTTGTTTGCCTGAGATCCTTTGTCTGGGGATGGGCTATGACGTTTCTGCGGCCGTTCTACAGCCTTCCCCAGACG
AGGATGCCCCCGCAGTCATGGCCTATCGACCTCTTTCTCATGGCACGCTGCGTCTACGCCGGGACGCTCCTGTTT
GTTGTGTGGTCCACGGGGAATATGGCATTTTCGGTCTTCATGGTCAAAGAGCCCCTGAAGAACGGGAAGCCTCTG
ACGTCGGAATCAAAGGACCCTAACGGGAGTCTTTTGAACGGGCTAAAGAGCAAGAAACCGTCTATCCAGGCATTC
GCTATGTGGGAGTTGGCGCTCATTGCCAAGGATTTTGATGCGCGCAGACAGGCCATATACCGCGACATCGACCAG
TTGCGTGTGGACCAGTACGGGAAGCCTGACACGTCGGCCGTCGTACAGACCACAGAGCCTTCAGTCAGGCCACGG
GTATCGGGGCCGCTGCGGGATGAGCCGATCCTCACTCAGACCAATCGGGCCTACGGGCTGGCTGGGGGCGTTGAA
AAGGCATGGGATCAAATTGGTCGAGCCCCCGGCGCTTCCCCGGTCTCGGAGCTGAGCCCGCTTGCGAAAAAGACG
TGGAAGGAGGCCAAGGACCGGCTTCTGAGCAAGGAGCAGCAGGAGGTGCTCTCGCCGGACCACATCAGGAGCGGA
CTGGAGCATTGGGCAGCCGGCTTGGTCGAGGTCCGGTGGCTCGGGAGCCTGCTACGGCAGGACTCGGGCACGCGG
CTGACGGCGACGATACTGGGCACGCCATATGCGGAGCCGACGCTCTACATCAACGCCGTGGAGGCGCTCTGTCAG
CTTGCAGTGCACAGCCTCTCGGAAGACGAGTTTGGCATCGTGCAGCGGGATGTGGCGAGTATCGTGCGGACGATG
ACGGCGGTGATGGACAAGGTGGAAGCTCTCAAGCGGCGATTCCCGAGTCATTGGATGGACCCTCGGAGGGTGCCT
CGGAGCCCCGCCGTGGACGCGGTCACGGAGGCGCTGCGCACGGGACTGGAGCGGCTAATGACGACGTTTGAGCCC
TACAGCCGCGACTTGGGCTTGTCACGAGGAGACGTCCGGCTGGCCAAGGAGGCGGCGGCGACGCCTCTAGATTTG
GCGCCTGTGACGAAAAGCACGGCCAGGGGCATCGAGAAGAAGAAGACGACGACGACGACGATTACGTCCAAGGCT
AGACGGGCGCAGGAGAAGAACCGGGAGAAGGACCGGGAGAAGGACCGGAAGAAGGACCGGGAGTGGGAGAGGGCG
CCGCGCGGCTTGGAGATGGAACAGGTGCAA
Transcript >Ophio5|910
ATGGCCGTCACACCGAGCCGCAGAGCTCCTTACAAGGACACGCTACAGCCCGCCTTGCATAGACGCTTCTCCTCA
ACGGCCACGCTCCTGCTAGCCGCGTCGTACCTCGAGGCTCTGCTCCTGGCGCCGTGGACTTCCTTCTTCTGGTCG
TGGTTTCCCTTTGGGCCTTGCGGCATCCGCACAGCTCTCATCTTTGCCTGTGGACTCGCGATCCTCGTCCTCCGC
ATCGCAAACTACCATGTCGGTTTCAGGACGACGACCTCGGGGCTGCAATCGCTCGGTTCAATACTGGCAAGCCCC
CGGTCGTACGAGACGGGCTTCTGGTACGGCTTTTCGGCCCTACTCTTTTGCCCCGTCTTCCTGGCTTCCATGCCC
GGCTCGGCCAACCTGCAATGGATCACGTACTTGAGCGGCGACCGTGCCCGGCTCAACGAGCGGCCTCTGATGTTG
GCTTGTCATCTGATAATGTGCGCGCTGTGGCAGACTATTCGCCACTACTGGCTCGATATAGATCATCTCGATCTT
GGGACGATGAAGCCGAAAGCAGAGGATCGAGGGACAGACTCGACCCCGCCGTCGGGGTCTCTTCACGCGATTGTG
TCCCAGGTCCCCAGGGTCCTCTCGGAATGCGCGTTCCAAGCGGGGCTCTCTTTGCCCTTTACCGTTGGTTTCTAT
TTTGTTTGCCTGAGATCCTTTGTCTGGGGATGGGCTATGACGTTTCTGCGGCCGTTCTACAGCCTTCCCCAGACG
AGGATGCCCCCGCAGTCATGGCCTATCGACCTCTTTCTCATGGCACGCTGCGTCTACGCCGGGACGCTCCTGTTT
GTTGTGTGGTCCACGGGGAATATGGCATTTTCGGTCTTCATGGTCAAAGAGCCCCTGAAGAACGGGAAGCCTCTG
ACGTCGGAATCAAAGGACCCTAACGGGAGTCTTTTGAACGGGCTAAAGAGCAAGAAACCGTCTATCCAGGCATTC
GCTATGTGGGAGTTGGCGCTCATTGCCAAGGATTTTGATGCGCGCAGACAGGCCATATACCGCGACATCGACCAG
TTGCGTGTGGACCAGTACGGGAAGCCTGACACGTCGGCCGTCGTACAGACCACAGAGCCTTCAGTCAGGCCACGG
GTATCGGGGCCGCTGCGGGATGAGCCGATCCTCACTCAGACCAATCGGGCCTACGGGCTGGCTGGGGGCGTTGAA
AAGGCATGGGATCAAATTGGTCGAGCCCCCGGCGCTTCCCCGGTCTCGGAGCTGAGCCCGCTTGCGAAAAAGACG
TGGAAGGAGGCCAAGGACCGGCTTCTGAGCAAGGAGCAGCAGGAGGTGCTCTCGCCGGACCACATCAGGAGCGGA
CTGGAGCATTGGGCAGCCGGCTTGGTCGAGGTCCGGTGGCTCGGGAGCCTGCTACGGCAGGACTCGGGCACGCGG
CTGACGGCGACGATACTGGGCACGCCATATGCGGAGCCGACGCTCTACATCAACGCCGTGGAGGCGCTCTGTCAG
CTTGCAGTGCACAGCCTCTCGGAAGACGAGTTTGGCATCGTGCAGCGGGATGTGGCGAGTATCGTGCGGACGATG
ACGGCGGTGATGGACAAGGTGGAAGCTCTCAAGCGGCGATTCCCGAGTCATTGGATGGACCCTCGGAGGGTGCCT
CGGAGCCCCGCCGTGGACGCGGTCACGGAGGCGCTGCGCACGGGACTGGAGCGGCTAATGACGACGTTTGAGCCC
TACAGCCGCGACTTGGGCTTGTCACGAGGAGACGTCCGGCTGGCCAAGGAGGCGGCGGCGACGCCTCTAGATTTG
GCGCCTGTGACGAAAAGCACGGCCAGGGGCATCGAGAAGAAGAAGACGACGACGACGACGATTACGTCCAAGGCT
AGACGGGCGCAGGAGAAGAACCGGGAGAAGGACCGGGAGAAGGACCGGAAGAAGGACCGGGAGTGGGAGAGGGCG
CCGCGCGGCTTGGAGATGGAACAGGTGCAATAG
Gene >Ophio5|910
ATGGCCGTCACACCGAGCCGCAGAGCTCCTTACAAGGACACGCTACAGCCCGCCTTGCATAGACGCTTCTCCTCA
ACGGCCACGCTCCTGCTAGCCGCGTCGTACCTCGAGGCTCTGCTCCTGGCGCCGTGGACTTCCTGTGAGTGCAAA
AAGCGCCTTTTTACCCTTTCTCACTCGGCCGATTCGACTTTGTGAAGCTGACGGTGCGCAGTCTTCTGGTCGTGG
TTTCCCTTTGGGCCTTGCGGCATCCGCACAGCTCTCATCTTTGCCTGTGGACTCGCGATCCTCGTCCTCCGCATC
GCAAACTACCATGTCGGTTTCAGGACGACGACCTCGGGGCTGCAATCGCTCGGTTCAATACTGGCAAGCCCCCGG
TCGTACGAGACGGGCTTCTGGTACGGCTTTTCGGCCCTACTCTTTTGCCCCGTCTTCCTGGCTTCCATGCCCGGC
TCGGCCAACCTGCAATGGATCACGTACTTGAGCGGCGACCGTGCCCGGCTCAACGAGCGGCCTCTGATGTTGGCT
TGTCATCTGATAATGTGCGCGCTGTGGCAGACTATTCGCCACTACTGGCTCGATATAGATCATCTCGATCTTGGG
ACGATGAAGCCGAAAGCAGAGGATCGAGGGACAGACTCGACCCCGCCGTCGGGGTCTCTTCACGCGATTGTGTCC
CAGGTCCCCAGGGTCCTCTCGGAATGCGCGTTCCAAGCGGGGCTCTCTTTGCCCTTTACCGTTGGTTTCTATTTT
GTTTGCCTGAGATCCTTTGTCTGGGGATGGGCTATGACGTTTCTGCGGCCGTTCTACAGCCTTCCCCAGACGAGG
ATGCCCCCGCAGTCATGGCCTATCGACCTCTTTCTCATGGCACGCTGCGTCTACGCCGGGACGCTCCTGTTTGTT
GTGTGGTCCACGGGGAATATGGCATTTTCGGTCTTCATGGTCAAAGAGCCCCTGAAGAACGGGAAGCCTCTGACG
TCGGAATCAAAGGACCCTAACGGGAGTCTTTTGAACGGGCTAAAGAGCAAGAAACCGTCTATCCAGGCAAGTGTA
GCCCGCTGCGTCGTCGCGACTCGAGTTGTCTCCCGCTAAACGGACATTAGGCATTCGCTATGTGGGAGTTGGCGC
TCATTGCCAAGGATTTTGATGCGCGCAGACAGGCCATATACCGCGACATCGACCGTAAGGATGGCCCCATGTGGA
CGCAGATTTGCGCCATCTGCATGGAAGTGCTGAAGAGCATAGAGTTGCGTGTGGACCAGTACGGGAAGCCTGACA
CGTCGGCCGTCGTACAGACCACAGAGCCTTCAGTCAGGCCACGGGTATCGGGGCCGCTGCGGGATGAGCCGATCC
TCACTCAGACCAATCGGGCCTACGGGCTGGCTGGGGGCGTTGAAAAGGCATGGGATCAAATTGGTCGAGCCCCCG
GCGCTTCCCCGGTCTCGGAGCTGAGCCCGCTTGCGAAAAAGACGTGGAAGGAGGCCAAGGACCGGCTTCTGAGCA
AGGAGCAGCAGGAGGTGCTCTCGCCGGACCACATCAGGAGCGGACTGGAGCATTGGGCAGCCGGCTTGGTCGAGG
TCCGGTGGCTCGGGAGCCTGCTACGGCAGGACTCGGGCACGCGGCTGACGGCGACGATACTGGGCACGCCATATG
CGGAGCCGACGCTCTACATCAACGCCGTGGAGGCGCTCTGTCAGCTTGCAGTGCACAGCCTCTCGGAAGACGAGT
TTGGCATCGTGCAGCGGGATGTGGCGAGTATCGTGCGGACGATGACGGCGGTGATGGACAAGGTGGAAGCTCTCA
AGCGGCGATTCCCGAGTCATTGGATGGACCCTCGGAGGGTGCCTCGGAGCCCCGCCGTGGACGCGGTCACGGAGG
CGCTGCGCACGGGACTGGAGCGGCTAATGACGACGTTTGAGCCCTACAGCCGCGACTTGGGCTTGTCACGAGGAG
ACGTCCGGCTGGCCAAGGAGGCGGCGGCGACGCCTCTAGATTTGGCGCCTGTGACGAAAAGCACGGCCAGGGGCA
TCGAGAAGAAGAAGACGACGACGACGACGATTACGTCCAAGGCTAGACGGGCGCAGGAGAAGAACCGGGAGAAGG
ACCGGGAGAAGGACCGGAAGAAGGACCGGGAGTGGGAGAGGGCGCCGCGCGGCTTGGAGATGGAACAGGTGCAAT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail