Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|90
Gene name
Locationscaffold_10:54204..56112
Strand+
Gene length (bp)1908
Transcript length (bp)1908
Coding sequence length (bp)1905
Protein length (aa) 635

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02450 LCAT Lecithin:cholesterol acyltransferase 2.5E-107 167 595

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94680|PDAT_SCHPO Phospholipid:diacylglycerol acyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plh1 PE=1 SV=2 54 631 0.0E+00
sp|P40345|PDAT_YEAST Phospholipid:diacylglycerol acyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LRO1 PE=1 SV=1 54 629 7.0E-168
sp|Q9FNA9|PDAT1_ARATH Phospholipid:diacylglycerol acyltransferase 1 OS=Arabidopsis thaliana GN=PDAT1 PE=2 SV=1 130 397 2.0E-54
sp|Q9FYC7|PDAT2_ARATH Putative phospholipid:diacylglycerol acyltransferase 2 OS=Arabidopsis thaliana GN=PDAT2 PE=3 SV=1 128 405 6.0E-53
sp|Q9FNA9|PDAT1_ARATH Phospholipid:diacylglycerol acyltransferase 1 OS=Arabidopsis thaliana GN=PDAT1 PE=2 SV=1 423 632 1.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94680|PDAT_SCHPO Phospholipid:diacylglycerol acyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plh1 PE=1 SV=2 54 631 0.0E+00
sp|P40345|PDAT_YEAST Phospholipid:diacylglycerol acyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LRO1 PE=1 SV=1 54 629 7.0E-168
sp|Q9FNA9|PDAT1_ARATH Phospholipid:diacylglycerol acyltransferase 1 OS=Arabidopsis thaliana GN=PDAT1 PE=2 SV=1 130 397 2.0E-54
sp|Q9FYC7|PDAT2_ARATH Putative phospholipid:diacylglycerol acyltransferase 2 OS=Arabidopsis thaliana GN=PDAT2 PE=3 SV=1 128 405 6.0E-53
sp|Q9FNA9|PDAT1_ARATH Phospholipid:diacylglycerol acyltransferase 1 OS=Arabidopsis thaliana GN=PDAT1 PE=2 SV=1 423 632 1.0E-27
sp|Q9FYC7|PDAT2_ARATH Putative phospholipid:diacylglycerol acyltransferase 2 OS=Arabidopsis thaliana GN=PDAT2 PE=3 SV=1 444 632 3.0E-26
sp|Q4VCM1|LCAT2_ARATH Phospholipid--sterol O-acyltransferase OS=Arabidopsis thaliana GN=PSAT PE=2 SV=2 145 552 7.0E-20
sp|P16301|LCAT_MOUSE Phosphatidylcholine-sterol acyltransferase OS=Mus musculus GN=Lcat PE=1 SV=2 127 503 2.0E-09
sp|P18424|LCAT_RAT Phosphatidylcholine-sterol acyltransferase OS=Rattus norvegicus GN=Lcat PE=1 SV=1 127 503 2.0E-09
sp|Q08758|LCAT_PAPAN Phosphatidylcholine-sterol acyltransferase OS=Papio anubis GN=LCAT PE=2 SV=1 127 355 2.0E-07
sp|P04180|LCAT_HUMAN Phosphatidylcholine-sterol acyltransferase OS=Homo sapiens GN=LCAT PE=1 SV=1 134 355 2.0E-07
sp|P53761|LCAT_RABIT Phosphatidylcholine-sterol acyltransferase OS=Oryctolagus cuniculus GN=LCAT PE=1 SV=1 127 355 6.0E-07
sp|Q675A5|PAG15_RAT Group XV phospholipase A2 OS=Rattus norvegicus GN=Pla2g15 PE=1 SV=1 141 573 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008374 O-acyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0016746 acyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 64 83 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|90
MAASLRRRHPSSSQQTQPQAAALDDDASSSDASPALPLQTGPLHVVEPLKVVDRTTKTRKRRNTLIFLLGGVCGL
FAAGFLAQSNDFIEFGDLSMDSLFDVLPAGLVRDMRDLVQGERDVTDSYDSFSVGLKARAEGLDAHHPMIMVPGV
ISTGLESWGTANISRQYFRKRLWGSWTMMRALVLDKETWKRHIMLDTRTGLDPPGVKLRAAQGFDATDFFITGYW
IWNKIFENLATIGYDPTNSFTAAYDWRLSYPNLEVRDQYFTRLKSYIETAVAFGDRKVVLASHSMGSQVIFYFFH
WVQSDQGGNGGEDWVDRHVESWINISGCMLGAVKDLTAVLSGEMRDTAQLNAFAIYGLEKFLSKEERANIFRAMP
GISSMLPLGGNAVWGDLNWAPDDALGQSFSYGSILNFKVGSNWTTPEKNLTIEESLDYLFRTADDWYGKQIKGSY
SHGVAQTAEEVKANEKDPRKWINPLETSLPNAPNLRIYCFYGVGKPTERAYYYRPPDQPAATNLTMTIDTGLTMA
EGKVDHGVVLGEGDGTVPLLSTGYMCNRGWHMKRYNPGGSRITVVEMPHEPDRFSPRGGPNTADHVDILGRQNLN
ELVLRVAAGKGDTITDYIISNIREYAARIKVQDDD
Coding >Ophio5|90
ATGGCCGCCTCGTTGCGACGCCGCCACCCGTCGTCGTCCCAGCAGACGCAACCGCAAGCCGCCGCTTTGGACGAC
GATGCGTCTTCCAGCGACGCAAGCCCGGCGTTACCGCTGCAGACGGGCCCCCTTCACGTCGTCGAGCCTCTCAAG
GTCGTCGACCGCACCACTAAGACGCGCAAGCGTCGCAACACGCTCATCTTCCTCCTCGGCGGCGTCTGCGGCCTA
TTTGCCGCCGGCTTTCTCGCCCAAAGCAATGACTTCATCGAATTCGGCGACCTTAGTATGGATAGCCTTTTCGAC
GTCCTGCCCGCCGGCCTCGTTCGAGACATGCGCGACCTTGTCCAGGGCGAGCGCGATGTCACCGACTCGTACGAC
TCCTTCTCCGTCGGGCTCAAGGCTCGTGCCGAGGGTCTCGACGCCCATCATCCCATGATAATGGTGCCCGGCGTC
ATCTCCACCGGACTCGAGTCGTGGGGCACTGCCAACATCTCGCGCCAGTACTTCAGGAAGCGTCTATGGGGCAGC
TGGACCATGATGAGGGCATTAGTTCTCGACAAGGAGACGTGGAAGAGGCACATCATGCTCGATACCCGCACCGGT
CTCGATCCGCCCGGTGTCAAGCTCCGCGCAGCTCAGGGCTTCGATGCTACCGACTTCTTTATCACCGGCTACTGG
ATCTGGAACAAGATCTTCGAGAATCTGGCCACCATTGGCTACGACCCGACGAATTCCTTCACGGCTGCATACGAC
TGGCGCCTCTCGTATCCGAACCTTGAGGTGCGCGACCAATACTTTACCCGTCTAAAGTCGTATATCGAGACCGCC
GTCGCCTTTGGCGATCGAAAAGTGGTGCTGGCCTCGCACAGCATGGGCAGCCAAGTCATCTTCTACTTCTTTCAC
TGGGTTCAGTCCGACCAGGGCGGAAACGGTGGCGAGGACTGGGTGGACCGCCATGTCGAATCGTGGATTAATATT
AGCGGCTGCATGCTCGGCGCCGTCAAAGACCTAACGGCCGTCTTATCCGGCGAGATGCGTGATACGGCTCAGCTT
AACGCGTTCGCCATCTATGGCCTCGAAAAGTTTCTCAGTAAAGAGGAGCGCGCCAACATCTTTCGGGCCATGCCG
GGCATCTCGTCGATGCTTCCCCTCGGCGGCAATGCCGTCTGGGGAGACCTGAACTGGGCCCCGGATGACGCCCTG
GGTCAGTCGTTTTCCTACGGCTCGATCCTCAACTTCAAGGTCGGGTCGAACTGGACGACGCCCGAGAAGAACCTG
ACGATCGAAGAATCGCTCGACTACCTCTTCCGCACAGCCGACGATTGGTACGGGAAGCAGATAAAGGGAAGCTAC
TCTCATGGCGTGGCGCAAACGGCGGAAGAAGTCAAGGCGAACGAAAAGGACCCGAGGAAGTGGATCAATCCGCTC
GAGACGAGCCTGCCCAACGCGCCGAACCTTCGAATCTACTGCTTCTACGGTGTGGGAAAGCCGACGGAGCGGGCC
TATTACTACCGACCACCAGACCAGCCGGCAGCCACCAACTTGACGATGACAATCGACACGGGGCTGACGATGGCC
GAGGGCAAAGTCGACCACGGGGTGGTGCTCGGCGAGGGCGACGGCACCGTCCCGCTCTTGAGTACGGGATACATG
TGCAACCGCGGATGGCACATGAAGCGATACAACCCAGGGGGCTCGCGGATCACGGTGGTGGAGATGCCGCACGAG
CCCGATCGGTTCAGCCCTCGAGGCGGGCCCAACACGGCCGACCACGTCGATATCCTGGGGAGGCAGAACCTCAAC
GAGCTCGTCCTCAGAGTTGCGGCGGGCAAGGGTGATACCATCACCGACTACATCATCAGCAACATCCGCGAGTAC
GCGGCCAGGATCAAGGTGCAGGACGACGAT
Transcript >Ophio5|90
ATGGCCGCCTCGTTGCGACGCCGCCACCCGTCGTCGTCCCAGCAGACGCAACCGCAAGCCGCCGCTTTGGACGAC
GATGCGTCTTCCAGCGACGCAAGCCCGGCGTTACCGCTGCAGACGGGCCCCCTTCACGTCGTCGAGCCTCTCAAG
GTCGTCGACCGCACCACTAAGACGCGCAAGCGTCGCAACACGCTCATCTTCCTCCTCGGCGGCGTCTGCGGCCTA
TTTGCCGCCGGCTTTCTCGCCCAAAGCAATGACTTCATCGAATTCGGCGACCTTAGTATGGATAGCCTTTTCGAC
GTCCTGCCCGCCGGCCTCGTTCGAGACATGCGCGACCTTGTCCAGGGCGAGCGCGATGTCACCGACTCGTACGAC
TCCTTCTCCGTCGGGCTCAAGGCTCGTGCCGAGGGTCTCGACGCCCATCATCCCATGATAATGGTGCCCGGCGTC
ATCTCCACCGGACTCGAGTCGTGGGGCACTGCCAACATCTCGCGCCAGTACTTCAGGAAGCGTCTATGGGGCAGC
TGGACCATGATGAGGGCATTAGTTCTCGACAAGGAGACGTGGAAGAGGCACATCATGCTCGATACCCGCACCGGT
CTCGATCCGCCCGGTGTCAAGCTCCGCGCAGCTCAGGGCTTCGATGCTACCGACTTCTTTATCACCGGCTACTGG
ATCTGGAACAAGATCTTCGAGAATCTGGCCACCATTGGCTACGACCCGACGAATTCCTTCACGGCTGCATACGAC
TGGCGCCTCTCGTATCCGAACCTTGAGGTGCGCGACCAATACTTTACCCGTCTAAAGTCGTATATCGAGACCGCC
GTCGCCTTTGGCGATCGAAAAGTGGTGCTGGCCTCGCACAGCATGGGCAGCCAAGTCATCTTCTACTTCTTTCAC
TGGGTTCAGTCCGACCAGGGCGGAAACGGTGGCGAGGACTGGGTGGACCGCCATGTCGAATCGTGGATTAATATT
AGCGGCTGCATGCTCGGCGCCGTCAAAGACCTAACGGCCGTCTTATCCGGCGAGATGCGTGATACGGCTCAGCTT
AACGCGTTCGCCATCTATGGCCTCGAAAAGTTTCTCAGTAAAGAGGAGCGCGCCAACATCTTTCGGGCCATGCCG
GGCATCTCGTCGATGCTTCCCCTCGGCGGCAATGCCGTCTGGGGAGACCTGAACTGGGCCCCGGATGACGCCCTG
GGTCAGTCGTTTTCCTACGGCTCGATCCTCAACTTCAAGGTCGGGTCGAACTGGACGACGCCCGAGAAGAACCTG
ACGATCGAAGAATCGCTCGACTACCTCTTCCGCACAGCCGACGATTGGTACGGGAAGCAGATAAAGGGAAGCTAC
TCTCATGGCGTGGCGCAAACGGCGGAAGAAGTCAAGGCGAACGAAAAGGACCCGAGGAAGTGGATCAATCCGCTC
GAGACGAGCCTGCCCAACGCGCCGAACCTTCGAATCTACTGCTTCTACGGTGTGGGAAAGCCGACGGAGCGGGCC
TATTACTACCGACCACCAGACCAGCCGGCAGCCACCAACTTGACGATGACAATCGACACGGGGCTGACGATGGCC
GAGGGCAAAGTCGACCACGGGGTGGTGCTCGGCGAGGGCGACGGCACCGTCCCGCTCTTGAGTACGGGATACATG
TGCAACCGCGGATGGCACATGAAGCGATACAACCCAGGGGGCTCGCGGATCACGGTGGTGGAGATGCCGCACGAG
CCCGATCGGTTCAGCCCTCGAGGCGGGCCCAACACGGCCGACCACGTCGATATCCTGGGGAGGCAGAACCTCAAC
GAGCTCGTCCTCAGAGTTGCGGCGGGCAAGGGTGATACCATCACCGACTACATCATCAGCAACATCCGCGAGTAC
GCGGCCAGGATCAAGGTGCAGGACGACGATTAG
Gene >Ophio5|90
ATGGCCGCCTCGTTGCGACGCCGCCACCCGTCGTCGTCCCAGCAGACGCAACCGCAAGCCGCCGCTTTGGACGAC
GATGCGTCTTCCAGCGACGCAAGCCCGGCGTTACCGCTGCAGACGGGCCCCCTTCACGTCGTCGAGCCTCTCAAG
GTCGTCGACCGCACCACTAAGACGCGCAAGCGTCGCAACACGCTCATCTTCCTCCTCGGCGGCGTCTGCGGCCTA
TTTGCCGCCGGCTTTCTCGCCCAAAGCAATGACTTCATCGAATTCGGCGACCTTAGTATGGATAGCCTTTTCGAC
GTCCTGCCCGCCGGCCTCGTTCGAGACATGCGCGACCTTGTCCAGGGCGAGCGCGATGTCACCGACTCGTACGAC
TCCTTCTCCGTCGGGCTCAAGGCTCGTGCCGAGGGTCTCGACGCCCATCATCCCATGATAATGGTGCCCGGCGTC
ATCTCCACCGGACTCGAGTCGTGGGGCACTGCCAACATCTCGCGCCAGTACTTCAGGAAGCGTCTATGGGGCAGC
TGGACCATGATGAGGGCATTAGTTCTCGACAAGGAGACGTGGAAGAGGCACATCATGCTCGATACCCGCACCGGT
CTCGATCCGCCCGGTGTCAAGCTCCGCGCAGCTCAGGGCTTCGATGCTACCGACTTCTTTATCACCGGCTACTGG
ATCTGGAACAAGATCTTCGAGAATCTGGCCACCATTGGCTACGACCCGACGAATTCCTTCACGGCTGCATACGAC
TGGCGCCTCTCGTATCCGAACCTTGAGGTGCGCGACCAATACTTTACCCGTCTAAAGTCGTATATCGAGACCGCC
GTCGCCTTTGGCGATCGAAAAGTGGTGCTGGCCTCGCACAGCATGGGCAGCCAAGTCATCTTCTACTTCTTTCAC
TGGGTTCAGTCCGACCAGGGCGGAAACGGTGGCGAGGACTGGGTGGACCGCCATGTCGAATCGTGGATTAATATT
AGCGGCTGCATGCTCGGCGCCGTCAAAGACCTAACGGCCGTCTTATCCGGCGAGATGCGTGATACGGCTCAGCTT
AACGCGTTCGCCATCTATGGCCTCGAAAAGTTTCTCAGTAAAGAGGAGCGCGCCAACATCTTTCGGGCCATGCCG
GGCATCTCGTCGATGCTTCCCCTCGGCGGCAATGCCGTCTGGGGAGACCTGAACTGGGCCCCGGATGACGCCCTG
GGTCAGTCGTTTTCCTACGGCTCGATCCTCAACTTCAAGGTCGGGTCGAACTGGACGACGCCCGAGAAGAACCTG
ACGATCGAAGAATCGCTCGACTACCTCTTCCGCACAGCCGACGATTGGTACGGGAAGCAGATAAAGGGAAGCTAC
TCTCATGGCGTGGCGCAAACGGCGGAAGAAGTCAAGGCGAACGAAAAGGACCCGAGGAAGTGGATCAATCCGCTC
GAGACGAGCCTGCCCAACGCGCCGAACCTTCGAATCTACTGCTTCTACGGTGTGGGAAAGCCGACGGAGCGGGCC
TATTACTACCGACCACCAGACCAGCCGGCAGCCACCAACTTGACGATGACAATCGACACGGGGCTGACGATGGCC
GAGGGCAAAGTCGACCACGGGGTGGTGCTCGGCGAGGGCGACGGCACCGTCCCGCTCTTGAGTACGGGATACATG
TGCAACCGCGGATGGCACATGAAGCGATACAACCCAGGGGGCTCGCGGATCACGGTGGTGGAGATGCCGCACGAG
CCCGATCGGTTCAGCCCTCGAGGCGGGCCCAACACGGCCGACCACGTCGATATCCTGGGGAGGCAGAACCTCAAC
GAGCTCGTCCTCAGAGTTGCGGCGGGCAAGGGTGATACCATCACCGACTACATCATCAGCAACATCCGCGAGTAC
GCGGCCAGGATCAAGGTGCAGGACGACGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail