Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|896
Gene name
Locationscaffold_127:94..960
Strand+
Gene length (bp)866
Transcript length (bp)768
Coding sequence length (bp)765
Protein length (aa) 255

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 119 141 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 305.26 160.98 449.53
CcL In ants, during behavior modification 213.96 110.78 317.14
CcD In ants, recently dead 261.17 138.41 383.92

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.138038 no
SC16a CcD 0.545007 no
CcL CcD 0.438894 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|896
MTSSTTTTTRLLAAAAATPARRVVRVRLPVFIRSFSSSSSSSSSSSSSSSSSTDRPIILEKPAKFNPPSHGSRLR
KSALPRHYSPPLSAAEAAARKQKDYPGLMAPEGSWAHWIWHSRLLHTFITMGALFTMALATFFLNYTQNSPFKDL
VPPMADLWQRPGHFFSAWKDVLVLHDREQTAKAIEHRMVHLDDVAKRIYYMKMHGIEVKNPITMAFGKGEEKQKA
ELAAPPAPDPASEAGAEEKPAPRTKWFGLW
Coding >Ophio5|896
ATGACGTCGTCGACGACGACGACGACGCGCCTCTTGGCTGCTGCTGCTGCTACTCCTGCGCGGCGCGTCGTCCGC
GTTCGTCTTCCGGTCTTCATCCGCTCTTTTTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCATCATCATCATCA
TCATCGACCGACCGACCCATCATTCTGGAGAAACCGGCAAAGTTCAACCCCCCGTCGCACGGCTCCCGGCTCCGC
AAGTCGGCTCTTCCCAGACACTATTCGCCGCCGCTGTCGGCTGCCGAGGCGGCGGCCCGCAAGCAGAAGGACTAT
CCTGGCTTGATGGCGCCCGAAGGGAGCTGGGCGCATTGGATATGGCATAGTCGGCTACTGCATACCTTCATCACC
ATGGGCGCGCTCTTCACAATGGCCTTAGCCACCTTCTTCCTCAACTACACGCAAAATTCGCCCTTCAAAGACCTC
GTGCCCCCCATGGCCGACCTCTGGCAACGGCCCGGCCACTTCTTTTCCGCCTGGAAGGACGTTTTGGTCCTGCAT
GATCGGGAACAGACGGCCAAGGCCATTGAGCACCGCATGGTGCACCTCGACGACGTCGCCAAGCGTATTTACTAC
ATGAAGATGCATGGTATCGAGGTCAAAAATCCCATCACCATGGCTTTTGGTAAGGGCGAGGAGAAGCAGAAGGCC
GAGTTGGCTGCCCCTCCGGCTCCTGATCCGGCATCCGAGGCCGGTGCCGAGGAGAAGCCAGCGCCGAGGACGAAA
TGGTTTGGCCTCTGG
Transcript >Ophio5|896
ATGACGTCGTCGACGACGACGACGACGCGCCTCTTGGCTGCTGCTGCTGCTACTCCTGCGCGGCGCGTCGTCCGC
GTTCGTCTTCCGGTCTTCATCCGCTCTTTTTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCATCATCATCATCA
TCATCGACCGACCGACCCATCATTCTGGAGAAACCGGCAAAGTTCAACCCCCCGTCGCACGGCTCCCGGCTCCGC
AAGTCGGCTCTTCCCAGACACTATTCGCCGCCGCTGTCGGCTGCCGAGGCGGCGGCCCGCAAGCAGAAGGACTAT
CCTGGCTTGATGGCGCCCGAAGGGAGCTGGGCGCATTGGATATGGCATAGTCGGCTACTGCATACCTTCATCACC
ATGGGCGCGCTCTTCACAATGGCCTTAGCCACCTTCTTCCTCAACTACACGCAAAATTCGCCCTTCAAAGACCTC
GTGCCCCCCATGGCCGACCTCTGGCAACGGCCCGGCCACTTCTTTTCCGCCTGGAAGGACGTTTTGGTCCTGCAT
GATCGGGAACAGACGGCCAAGGCCATTGAGCACCGCATGGTGCACCTCGACGACGTCGCCAAGCGTATTTACTAC
ATGAAGATGCATGGTATCGAGGTCAAAAATCCCATCACCATGGCTTTTGGTAAGGGCGAGGAGAAGCAGAAGGCC
GAGTTGGCTGCCCCTCCGGCTCCTGATCCGGCATCCGAGGCCGGTGCCGAGGAGAAGCCAGCGCCGAGGACGAAA
TGGTTTGGCCTCTGGTAA
Gene >Ophio5|896
ATGACGTCGTCGACGACGACGACGACGCGCCTCTTGGCTGCTGCTGCTGCTACTCCTGCGCGGCGCGTCGTCCGC
GTTCGTCTTCCGGTCTTCATCCGCTCTTTTTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCATCATCATCATCA
TCATCGACCGACCGACCCATCATTCTGGAGAAACCGGCAAAGTTCAACCCCCCGTCGCACGGCTCCCGGCTCCGC
AAGTCGGCTCTTCCCAGACACTATTCGCCGCCGCTGTCGGCTGCCGAGGCGGCGGCCCGCAAGCAGAAGGACTAT
CCTGGCTTGATGGCGCCCGAAGGGAGCTGGGCGCATTGGATATGGCATAGTCGGCTACTGCATACCTTCATCACC
ATGGTGCGCCTCTTTTTTTTTTCTTTCTTTCATACCCTTATCTTTTTGACCTGGCGCTTCTTCTCTCTTCTTCTG
ACCTCGACGGCGTCTGCTGCTCACAGGGCGCGCTCTTCACAATGGCCTTAGCCACCTTCTTCCTCAACTACACGC
AAAATTCGCCCTTCAAAGACCTCGTGCCCCCCATGGCCGACCTCTGGCAACGGCCCGGCCACTTCTTTTCCGCCT
GGAAGGACGTTTTGGTCCTGCATGATCGGGAACAGACGGCCAAGGCCATTGAGCACCGCATGGTGCACCTCGACG
ACGTCGCCAAGCGTATTTACTACATGAAGATGCATGGTATCGAGGTCAAAAATCCCATCACCATGGCTTTTGGTA
AGGGCGAGGAGAAGCAGAAGGCCGAGTTGGCTGCCCCTCCGGCTCCTGATCCGGCATCCGAGGCCGGTGCCGAGG
AGAAGCCAGCGCCGAGGACGAAATGGTTTGGCCTCTGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail