Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|894
Gene name
Locationscaffold_1269:391..1514
Strand+
Gene length (bp)1123
Transcript length (bp)780
Coding sequence length (bp)777
Protein length (aa) 259

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04161 Arv1 Arv1-like family 1.2E-40 32 189

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9HDX5|ARV1_SCHPO Protein arv1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arv1 PE=3 SV=3 4 239 5.0E-26
sp|Q5ANH2|ARV1_CANAL Protein ARV1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARV1 PE=3 SV=1 3 197 4.0E-10
sp|Q750Q7|ARV1_ASHGO Protein ARV1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARV1 PE=3 SV=1 3 250 8.0E-10
sp|Q54GD9|ARV1_DICDI Protein arv1 homolog OS=Dictyostelium discoideum GN=arv1 PE=3 SV=1 3 207 2.0E-08
sp|Q06541|ARV1_YEAST Protein ARV1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARV1 PE=1 SV=1 66 219 9.0E-07

GO

GO Term Description Terminal node
GO:0032366 intracellular sterol transport Yes
GO:0051649 establishment of localization in cell No
GO:0051641 cellular localization No
GO:0009987 cellular process No
GO:0015850 organic hydroxy compound transport No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0046907 intracellular transport No
GO:0071702 organic substance transport No
GO:0015918 sterol transport No
GO:0006869 lipid transport No
GO:0032365 intracellular lipid transport No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 98 120 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|894
MPICIECRHYVKTLWTKYSGAGDQSSGHNIRLTPQVYRHLLHNTLMREWDGFDPSIIRLGVLLLLFDVYLTWARI
EKQTIPATSPSESNLGRLARQPIVLQYLFFLLLCTLSTTAFHISIRFLASSQHSPLHSLGIMGRRTRPNSISTAL
LVSSSTKLFPILMVIWEYDVPAAARSLGWAVVANNVEALRILLDCKYHTACILAFAGAASRWAMGRMVLTLAGLG
DVDSISESSVAADGKALWGLVILVKEWAGHLAMG
Coding >Ophio5|894
ATGCCTATCTGCATCGAATGCCGACATTATGTGAAAACGCTCTGGACGAAGTACTCTGGCGCGGGCGATCAGTCC
TCTGGCCATAACATTCGATTGACGCCGCAAGTCTATCGCCATCTTTTACACAACACCTTGATGCGCGAATGGGAT
GGCTTCGATCCATCCATCATACGTCTTGGGGTATTGCTACTTTTGTTCGATGTCTACCTGACGTGGGCTCGCATT
GAGAAGCAGACCATACCCGCTACATCGCCTAGTGAAAGCAACCTGGGCCGACTGGCGCGACAGCCCATTGTATTG
CAGTACCTATTCTTTTTATTGCTGTGTACACTGTCAACCACGGCCTTTCATATCAGCATTCGTTTCCTAGCATCC
TCACAACACTCGCCCCTCCATTCCCTAGGAATAATGGGTCGACGGACGAGACCAAACTCGATTTCGACAGCCCTT
CTTGTCTCGTCGTCTACGAAACTTTTTCCTATTTTAATGGTGATATGGGAGTATGACGTTCCAGCTGCGGCCCGC
TCCCTTGGATGGGCAGTTGTGGCCAACAATGTCGAGGCTTTACGGATTCTATTAGACTGCAAATACCACACGGCT
TGCATCCTGGCTTTTGCTGGTGCAGCATCACGTTGGGCTATGGGGCGAATGGTACTCACGTTGGCAGGACTAGGT
GATGTCGATTCGATCAGCGAAAGCAGTGTGGCTGCCGATGGCAAAGCCCTTTGGGGTCTGGTGATTCTAGTTAAA
GAATGGGCAGGCCACTTGGCAATGGGC
Transcript >Ophio5|894
ATGCCTATCTGCATCGAATGCCGACATTATGTGAAAACGCTCTGGACGAAGTACTCTGGCGCGGGCGATCAGTCC
TCTGGCCATAACATTCGATTGACGCCGCAAGTCTATCGCCATCTTTTACACAACACCTTGATGCGCGAATGGGAT
GGCTTCGATCCATCCATCATACGTCTTGGGGTATTGCTACTTTTGTTCGATGTCTACCTGACGTGGGCTCGCATT
GAGAAGCAGACCATACCCGCTACATCGCCTAGTGAAAGCAACCTGGGCCGACTGGCGCGACAGCCCATTGTATTG
CAGTACCTATTCTTTTTATTGCTGTGTACACTGTCAACCACGGCCTTTCATATCAGCATTCGTTTCCTAGCATCC
TCACAACACTCGCCCCTCCATTCCCTAGGAATAATGGGTCGACGGACGAGACCAAACTCGATTTCGACAGCCCTT
CTTGTCTCGTCGTCTACGAAACTTTTTCCTATTTTAATGGTGATATGGGAGTATGACGTTCCAGCTGCGGCCCGC
TCCCTTGGATGGGCAGTTGTGGCCAACAATGTCGAGGCTTTACGGATTCTATTAGACTGCAAATACCACACGGCT
TGCATCCTGGCTTTTGCTGGTGCAGCATCACGTTGGGCTATGGGGCGAATGGTACTCACGTTGGCAGGACTAGGT
GATGTCGATTCGATCAGCGAAAGCAGTGTGGCTGCCGATGGCAAAGCCCTTTGGGGTCTGGTGATTCTAGTTAAA
GAATGGGCAGGCCACTTGGCAATGGGCTAA
Gene >Ophio5|894
ATGCCTATCTGCATCGAATGCCGACATTATGTGAAAACGCTCTGGACGAAGTACTCTGGCGCGGGCGATCAGTCC
TCTGGCCATAACATTCGATTGACGGTATGCCGTCAGTGTGGCCGTTTTTGCGATAAATATGTCGAGCATGACTTC
ATCGTTCTCTTCATTGACCTTGTGTTGATCAAGCCGCAAGTGTGTTTCTGGTCGTCCTCTTCTTTTGACGCTCTC
GCGGTTCTGATGTTGCGGTCAAGGTCTATCGCCATCTTTTACACAACACCTTGATGCGCGAATGGGATGGCTTCG
ATGTAAGTTGTGTCTGTCGGCTGTGGTCTCCTCGCACCACTTAAGCCCACACGTCTTTGATGTCAACCCTCATCC
CTTCAAATCAATAGCTGTCAAAGGGTAGTAACTGCGTTTCCCAGCTAACTGAGGTATTTCCTGAGAATGTAGCCA
TCCATCATACGTCTTGGGGTATTGCTACTTTTGTTCGATGTCTACCTGACGTGGGCTCGCATTGAGAAGCAGACC
ATACCCGCTACATCGCCTAGTGAAAGCAACCTGGGCCGACTGGCGCGACAGCCCATTGTATTGCAGTACCTATTC
TTTTGTCAGTTCAGGTCACGTCTCACAATACGGGATCGCCGTAGCTCACAGCTTTCTAGTATTGCTGTGTACACT
GTCAACCACGGCCTTTCATATCAGCATTCGTTTCCTAGCATCCTCACAACACTCGCCCCTCCATTCCCTAGGAAT
AATGGGTCGACGGACGAGACCAAACTCGATTTCGACAGCCCTTCTTGTCTCGTCGTCTACGAAACTTTTTCCTAT
TTTAATGGTGATATGGGAGTATGACGTTCCAGCTGCGGCCCGCTCCCTTGGATGGGCAGTTGTGGCCAACAATGT
CGAGGCTTTACGGATTCTATTAGACTGCAAATACCACACGGCTTGCATCCTGGCTTTTGCTGGTGCAGCATCACG
TTGGGCTATGGGGCGAATGGTACTCACGTTGGCAGGACTAGGTGATGTCGATTCGATCAGCGAAAGCAGTGTGGC
TGCCGATGGCAAAGCCCTTTGGGGTCTGGTGATTCTAGTTAAAGAATGGGCAGGCCACTTGGCAATGGGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail