Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8629
Gene name
Locationscaffold_998:3198..4163
Strand-
Gene length (bp)965
Transcript length (bp)903
Coding sequence length (bp)900
Protein length (aa) 300

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10503 Esterase_PHB Esterase PHB depolymerase 5.5E-07 55 183
PF00756 Esterase Putative esterase 4.0E-05 50 184

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2QYU7|FAEC_ASPNC Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeC PE=3 SV=1 7 296 3.0E-19
sp|A1CC33|FAEC2_ASPCL Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=faeC-2 PE=3 SV=1 8 296 7.0E-18
sp|A4D9B6|FAEC_ASPFU Probable feruloyl esterase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=faeC PE=3 SV=1 6 252 1.0E-16
sp|B0XU32|FAEC_ASPFC Probable feruloyl esterase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=faeC PE=3 SV=1 6 252 1.0E-16
sp|Q9Y871|FAEB_PIREQ Feruloyl esterase B OS=Piromyces equi GN=ESTA PE=2 SV=1 34 260 6.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2QYU7|FAEC_ASPNC Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeC PE=3 SV=1 7 296 3.0E-19
sp|A1CC33|FAEC2_ASPCL Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=faeC-2 PE=3 SV=1 8 296 7.0E-18
sp|A4D9B6|FAEC_ASPFU Probable feruloyl esterase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=faeC PE=3 SV=1 6 252 1.0E-16
sp|B0XU32|FAEC_ASPFC Probable feruloyl esterase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=faeC PE=3 SV=1 6 252 1.0E-16
sp|Q9Y871|FAEB_PIREQ Feruloyl esterase B OS=Piromyces equi GN=ESTA PE=2 SV=1 34 260 6.0E-16
sp|A1DI08|FAEC_NEOFI Probable feruloyl esterase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=faeC PE=3 SV=1 6 213 1.0E-15
sp|Q0CDX2|FAEC_ASPTN Probable feruloyl esterase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=faeC PE=3 SV=1 11 241 5.0E-15
sp|A1C9D4|FAEC1_ASPCL Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=faeC-1 PE=3 SV=1 6 296 7.0E-15
sp|B8N7Z6|FAEC_ASPFN Probable feruloyl esterase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeC PE=3 SV=1 7 213 2.0E-14
sp|Q5B2G3|FAEC_EMENI Feruloyl esterase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=faeC PE=1 SV=1 7 296 3.0E-14
sp|Q2UI81|FAEC_ASPOR Probable feruloyl esterase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=faeC PE=3 SV=2 7 213 3.0E-14
sp|Q7RWX8|FAED_NEUCR Feruloyl esterase D OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=faeD-3.544 PE=1 SV=1 30 265 1.0E-12
sp|B8YG19|XS20E_NEOPA Bifunctional acetylxylan esterase/xylanase XynS20E OS=Neocallimastix patriciarum GN=xynS20E PE=1 SV=1 69 215 6.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0005576 extracellular region Yes
GO:0110165 cellular anatomical entity No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8629
MARHPHRLLFLLVALTVSVAATAHLAASLGCGHDHDFAGSSRNFSIQSGGRTRQYRLHLPSAYDKYKPAPLLLAF
HGAGDNPVNFEQKTHFSDEHVNRGMIIVYPAGFKKHWEGPKYATPGVDDKTFISDLIGHLLDSYCVDVSRIYATG
HSNGGGFVNSLACSPDHGRYFAAVAPVSGAFYTDDTACRPHRLPLPVMEIHGTADRTIPYTGGEGRGGTLPSIAE
WLERWARRDGCNTLPVEVGLSSSRVHVLRWTNCHGRDDVLRHVRLDGATHKWPGKDSAFDASPAIVEFLLAHRKV
Coding >Ophio5|8629
ATGGCGAGACATCCCCACCGTCTTCTTTTTCTCCTCGTGGCCTTGACCGTTTCTGTCGCCGCCACCGCCCATCTG
GCCGCATCTCTGGGCTGCGGACACGATCATGACTTTGCCGGCTCGTCACGCAACTTTTCCATTCAGAGCGGCGGC
CGAACACGCCAGTATCGTCTTCACTTGCCTTCCGCCTACGACAAGTACAAGCCCGCGCCGCTGCTGCTCGCCTTT
CATGGCGCGGGCGACAATCCGGTCAACTTCGAGCAAAAGACGCACTTCTCTGACGAGCATGTCAATCGCGGCATG
ATTATCGTCTATCCTGCTGGCTTCAAAAAACACTGGGAGGGCCCCAAATACGCCACCCCCGGCGTCGACGACAAG
ACCTTTATATCCGACCTCATTGGCCATCTCTTGGATTCTTACTGCGTCGACGTTTCCCGCATCTACGCAACCGGT
CACTCCAACGGCGGCGGCTTTGTCAACTCGCTGGCCTGCTCGCCCGACCATGGCCGATACTTTGCCGCCGTGGCC
CCCGTCTCGGGCGCTTTCTACACCGACGACACCGCCTGCCGTCCGCACCGCCTGCCGCTGCCCGTCATGGAGATT
CACGGCACGGCCGACAGGACGATACCGTATACCGGCGGCGAAGGCCGTGGCGGAACTTTGCCTTCTATTGCCGAG
TGGCTGGAACGCTGGGCTCGGAGGGATGGCTGCAATACACTGCCAGTCGAGGTGGGCTTGTCATCGAGCCGTGTT
CATGTTCTGCGCTGGACGAATTGTCATGGCCGTGATGATGTATTGCGCCATGTGCGTTTGGACGGCGCGACGCAT
AAGTGGCCGGGCAAGGACTCTGCTTTTGATGCGTCGCCGGCCATTGTCGAGTTCCTGCTGGCCCATCGAAAGGTG
Transcript >Ophio5|8629
ATGGCGAGACATCCCCACCGTCTTCTTTTTCTCCTCGTGGCCTTGACCGTTTCTGTCGCCGCCACCGCCCATCTG
GCCGCATCTCTGGGCTGCGGACACGATCATGACTTTGCCGGCTCGTCACGCAACTTTTCCATTCAGAGCGGCGGC
CGAACACGCCAGTATCGTCTTCACTTGCCTTCCGCCTACGACAAGTACAAGCCCGCGCCGCTGCTGCTCGCCTTT
CATGGCGCGGGCGACAATCCGGTCAACTTCGAGCAAAAGACGCACTTCTCTGACGAGCATGTCAATCGCGGCATG
ATTATCGTCTATCCTGCTGGCTTCAAAAAACACTGGGAGGGCCCCAAATACGCCACCCCCGGCGTCGACGACAAG
ACCTTTATATCCGACCTCATTGGCCATCTCTTGGATTCTTACTGCGTCGACGTTTCCCGCATCTACGCAACCGGT
CACTCCAACGGCGGCGGCTTTGTCAACTCGCTGGCCTGCTCGCCCGACCATGGCCGATACTTTGCCGCCGTGGCC
CCCGTCTCGGGCGCTTTCTACACCGACGACACCGCCTGCCGTCCGCACCGCCTGCCGCTGCCCGTCATGGAGATT
CACGGCACGGCCGACAGGACGATACCGTATACCGGCGGCGAAGGCCGTGGCGGAACTTTGCCTTCTATTGCCGAG
TGGCTGGAACGCTGGGCTCGGAGGGATGGCTGCAATACACTGCCAGTCGAGGTGGGCTTGTCATCGAGCCGTGTT
CATGTTCTGCGCTGGACGAATTGTCATGGCCGTGATGATGTATTGCGCCATGTGCGTTTGGACGGCGCGACGCAT
AAGTGGCCGGGCAAGGACTCTGCTTTTGATGCGTCGCCGGCCATTGTCGAGTTCCTGCTGGCCCATCGAAAGGTG
TGA
Gene >Ophio5|8629
ATGGCGAGACATCCCCACCGTCTTCTTTTTCTCCTCGTGGCCTTGACCGTTTCTGTCGCCGCCACCGCCCATCTG
GCCGCATCTCTGGGCTGCGGACACGATCATGACTTTGCCGGCTCGTCACGCAACTTTTCCATTCAGAGCGGCGGC
CGAACACGCCAGTATCGTCTTCACTTGCCTTCCGCCTACGACAAGTACAAGCCCGCGCCGCTGCTGCTCGCCTTT
CATGGCGCGGGCGACAATCCGGTCAACTTCGAGCAAAAGACGCACTTCTCTGACGAGCATGTCAATCGCGGCATG
ATTATCGTCTATCCTGCTGGCTTCAAAGCAAGCATCGGGCTCCCTCTCATAGTATAGAGCAGTCAGAAAAGACTA
ATAAACGCAATCAGAAACACTGGGAGGGCCCCAAATACGCCACCCCCGGCGTCGACGACAAGACCTTTATATCCG
ACCTCATTGGCCATCTCTTGGATTCTTACTGCGTCGACGTTTCCCGCATCTACGCAACCGGTCACTCCAACGGCG
GCGGCTTTGTCAACTCGCTGGCCTGCTCGCCCGACCATGGCCGATACTTTGCCGCCGTGGCCCCCGTCTCGGGCG
CTTTCTACACCGACGACACCGCCTGCCGTCCGCACCGCCTGCCGCTGCCCGTCATGGAGATTCACGGCACGGCCG
ACAGGACGATACCGTATACCGGCGGCGAAGGCCGTGGCGGAACTTTGCCTTCTATTGCCGAGTGGCTGGAACGCT
GGGCTCGGAGGGATGGCTGCAATACACTGCCAGTCGAGGTGGGCTTGTCATCGAGCCGTGTTCATGTTCTGCGCT
GGACGAATTGTCATGGCCGTGATGATGTATTGCGCCATGTGCGTTTGGACGGCGCGACGCATAAGTGGCCGGGCA
AGGACTCTGCTTTTGATGCGTCGCCGGCCATTGTCGAGTTCCTGCTGGCCCATCGAAAGGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail