Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8623
Gene name
Locationscaffold_996:1851..2186
Strand+
Gene length (bp)335
Transcript length (bp)273
Coding sequence length (bp)270
Protein length (aa) 90

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 2.34 0.00 7.10
CcL In ants, during behavior modification 9.09 0.98 17.20
CcD In ants, recently dead 8.37 0.00 17.59

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.147463 no
SC16a CcD 0.133051 no
CcL CcD 0.914615 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8623
MFALRSFFAICLTYSNGYPFWRACRGRSLSPPIILSRGGHHQTSPLIQKGMMLLKEQSKKMLPQTPTHPDCAPAD
RSRRGCAEDKQGMDG
Coding >Ophio5|8623
ATGTTTGCCCTCCGGAGCTTTTTTGCCATCTGTCTGACATACAGTAATGGATATCCTTTTTGGCGCGCTTGCCGC
GGCCGATCCCTCTCCCCCCCAATCATCTTGAGCAGAGGAGGTCATCATCAAACGAGCCCGCTCATACAAAAAGGC
ATGATGCTACTAAAAGAGCAGAGCAAAAAAATGCTACCTCAAACTCCTACCCACCCCGACTGTGCCCCAGCCGAC
CGGAGCCGAAGAGGCTGTGCAGAGGACAAACAAGGGATGGATGGG
Transcript >Ophio5|8623
ATGTTTGCCCTCCGGAGCTTTTTTGCCATCTGTCTGACATACAGTAATGGATATCCTTTTTGGCGCGCTTGCCGC
GGCCGATCCCTCTCCCCCCCAATCATCTTGAGCAGAGGAGGTCATCATCAAACGAGCCCGCTCATACAAAAAGGC
ATGATGCTACTAAAAGAGCAGAGCAAAAAAATGCTACCTCAAACTCCTACCCACCCCGACTGTGCCCCAGCCGAC
CGGAGCCGAAGAGGCTGTGCAGAGGACAAACAAGGGATGGATGGGTGA
Gene >Ophio5|8623
ATGTTTGCCCTCCGGAGCTTTTTTGCCATCTGTCTGACATACAGTAATGGATATCCTTTTTGGCGCGCTTGCCGC
GGCCGATCCCTCTCCCCCCCAATCATCTTGAGCAGAGGAGGTCATCGTGAGTTACAAACAAAAGAAAAAGTAACT
CGTCACTTACCTTTGTCCTCTCGAGCCTATTAGATCAAACGAGCCCGCTCATACAAAAAGGCATGATGCTACTAA
AAGAGCAGAGCAAAAAAATGCTACCTCAAACTCCTACCCACCCCGACTGTGCCCCAGCCGACCGGAGCCGAAGAG
GCTGTGCAGAGGACAAACAAGGGATGGATGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail