Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8620
Gene name
Locationscaffold_994:903..4061
Strand-
Gene length (bp)3158
Transcript length (bp)2571
Coding sequence length (bp)2568
Protein length (aa) 856

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 1.3E-35 195 419

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P52958|CTF1A_FUSSO Cutinase transcription factor 1 alpha OS=Fusarium solani subsp. pisi GN=CTF1-ALPHA PE=2 SV=1 112 856 0.0E+00
sp|Q4WK35|AMDR_ASPFU Acetamidase regulatory protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=amdR PE=3 SV=1 122 646 3.0E-64
sp|Q06157|AMDR_ASPOR Acetamidase regulatory protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amdR PE=2 SV=2 122 598 3.0E-59
sp|P15699|AMDR_EMENI Acetamidase regulatory protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=amdR PE=3 SV=2 122 598 9.0E-55
sp|P52959|CTF1B_FUSSO Cutinase transcription factor 1 beta OS=Fusarium solani subsp. pisi GN=CTF1-BETA PE=2 SV=1 167 564 1.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P52958|CTF1A_FUSSO Cutinase transcription factor 1 alpha OS=Fusarium solani subsp. pisi GN=CTF1-ALPHA PE=2 SV=1 112 856 0.0E+00
sp|Q4WK35|AMDR_ASPFU Acetamidase regulatory protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=amdR PE=3 SV=1 122 646 3.0E-64
sp|Q06157|AMDR_ASPOR Acetamidase regulatory protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amdR PE=2 SV=2 122 598 3.0E-59
sp|P15699|AMDR_EMENI Acetamidase regulatory protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=amdR PE=3 SV=2 122 598 9.0E-55
sp|P52959|CTF1B_FUSSO Cutinase transcription factor 1 beta OS=Fusarium solani subsp. pisi GN=CTF1-BETA PE=2 SV=1 167 564 1.0E-47
sp|O14130|YF54_SCHPO Uncharacterized transcriptional regulatory protein C3C7.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.04 PE=3 SV=1 179 539 4.0E-14
sp|O59741|YN25_SCHPO Uncharacterized transcriptional regulatory protein C530.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.05 PE=3 SV=2 111 650 2.0E-11
sp|P87000|ACU15_NEUCR Transcriptional activator protein acu-15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-15 PE=1 SV=2 185 470 3.0E-10
sp|Q9P6I9|YHDD_SCHPO Uncharacterized transcriptional regulatory protein C1683.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.13c PE=1 SV=1 191 564 3.0E-10
sp|Q9P7H9|YIT3_SCHPO Uncharacterized transcriptional regulatory protein C105.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC105.03c PE=3 SV=1 192 439 1.0E-09
sp|P08657|LAC9_KLULA Lactose regulatory protein LAC9 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC9 PE=1 SV=1 177 364 2.0E-08
sp|O94490|YC79_SCHPO Uncharacterized transcriptional regulatory protein C417.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.09c PE=3 SV=1 260 373 9.0E-08
sp|Q09922|YAKB_SCHPO Uncharacterized transcriptional regulatory protein C1F7.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F7.11c PE=3 SV=1 184 411 1.0E-06
sp|Q9UTA7|YL8B_SCHPO Uncharacterized transcriptional regulatory protein C25B8.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.11 PE=3 SV=1 194 419 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0003677 DNA binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0003676 nucleic acid binding No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0019438 aromatic compound biosynthetic process No
GO:0016070 RNA metabolic process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0046914 transition metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0009059 macromolecule biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0032774 RNA biosynthetic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8620
MEAEVPSAVEAATPHRQPSPYSLSNSKSQYSEHLEHARPVMPERFDAMPLASVFPARIAWPFKSSAASRRPSVRN
LPTPLHLRRPKIPTVNATCLTTDHYWNPFCTHNGGSIMKPKFTRAPITEAGRVAFLGESSNLTLLVHDRQGSSDV
VHYPLPENIRGSRARLTELDVVEIDILHQRGAFLLPPRSLCDELIDAYFKWVHPIVPVINRSRFLRQYRDSTNPP
SLLLLQAVLLAGSRVCTNAQLMDANGSTNPAALTFYKRAKALYDANYEDDRVTIVQSLLLLGWYWEGPEDVTKNV
FYWSRVATIVAQGSGMHRSVEQSQLSKSDKRLWKRIWWTLFTRDRSVAVALGRPVHINLDDSDVEMLTEDDFIED
EPDGACDPAPDAVHVHFFLQYVKLCEIMGLVLSQQYSVASKGRQWNALDLTHSDMALADWLHNCPKIVYWEMPRH
HFWSALLHSNYYTTLCLLHRAHMPPGGSGRLPADSPYPSRHIAFQAAAMITSIVENLAAHNELRFCPAFVVYSLF
SALIMHVYQMRSPVPSIQQTTQARLRSCMEAMREVSRVWLVGKMVYTLFESIIGNKMLEERLQKAGTKRRRKMPQ
SLSQLEHQTRSSDASKRKFDDIAIDFTANAPTPQESYERSRPQTPSTSCKNDGGSTMQPPDLPSPGARPETGTDA
FMGGTASRPQTRPASPFYPSLSLPATTPDLYLVTRNSPNLSHSLWENFQPDQLFPESSSLPVIPRLSPTQAHDNL
DQDVMARLTPSNMAPPLQGEPATSFPARGQDQGNGLINVPGFQAQPAIWHSNVDLGLHDGQSPDSWSTGSAQGQS
APTTLNVEDWFQFFGINGGDTNPLSLDIPLG
Coding >Ophio5|8620
ATGGAGGCGGAAGTGCCCTCCGCCGTTGAGGCTGCGACGCCTCACCGTCAACCTTCACCATACTCGCTATCGAAT
TCGAAATCGCAATACAGCGAGCATCTCGAGCATGCGAGACCTGTCATGCCCGAAAGGTTCGATGCGATGCCGCTA
GCCTCGGTGTTCCCTGCACGAATTGCGTGGCCTTTCAAATCGAGTGCCGCATCCCGACGCCCAAGCGTAAGAAAC
CTGCCCACTCCGCTCCATCTCAGGCGACCAAAGATTCCGACAGTGAACGCGACTTGCTTGACGACCGACCACTAC
TGGAACCCCTTCTGTACCCACAACGGAGGCTCAATTATGAAGCCGAAGTTCACTCGTGCACCAATTACTGAAGCT
GGCAGGGTCGCATTTCTTGGCGAGTCGTCCAACTTAACCTTACTTGTTCACGACCGACAGGGCTCATCTGACGTC
GTTCACTATCCGCTTCCTGAGAATATTCGCGGCTCACGCGCCAGGCTTACGGAGCTAGACGTCGTCGAGATCGAT
ATCTTGCATCAGCGTGGGGCCTTTCTTTTACCGCCTCGTTCTTTATGCGATGAGCTAATCGACGCCTACTTCAAA
TGGGTTCACCCTATCGTTCCTGTCATAAACCGATCGCGATTTCTAAGGCAGTATCGCGACTCCACAAATCCACCA
TCCCTTTTACTTCTTCAGGCTGTTCTCCTGGCCGGCTCCCGTGTCTGCACAAATGCTCAGCTTATGGACGCAAAC
GGATCGACCAATCCCGCAGCGCTGACATTCTATAAGCGGGCCAAAGCGCTTTATGATGCCAACTACGAAGATGAC
CGCGTCACAATCGTTCAGTCCCTATTGCTACTGGGCTGGTACTGGGAAGGCCCTGAGGATGTGACCAAGAACGTG
TTCTACTGGAGCCGCGTTGCCACGATTGTTGCTCAAGGTTCCGGCATGCATCGCAGCGTGGAGCAATCGCAGCTC
AGCAAGTCCGACAAGCGGTTATGGAAGCGCATCTGGTGGACTCTTTTCACCCGCGACAGATCTGTAGCTGTTGCC
CTGGGCCGCCCGGTGCACATAAACCTGGATGACTCGGACGTTGAGATGTTAACCGAAGACGACTTTATCGAGGAC
GAACCAGATGGTGCTTGTGACCCCGCACCCGATGCAGTTCATGTCCATTTTTTCCTGCAATATGTCAAGCTTTGC
GAGATCATGGGCCTCGTGTTGTCGCAACAGTACTCAGTTGCCTCCAAAGGTCGCCAGTGGAATGCTCTTGACTTG
ACACACAGCGACATGGCACTCGCCGACTGGCTTCACAATTGCCCCAAGATCGTGTACTGGGAAATGCCTCGTCAT
CATTTCTGGTCGGCTCTTCTACACTCCAATTACTACACAACACTATGTCTTCTGCATAGGGCTCATATGCCTCCT
GGCGGCTCAGGCCGCTTACCGGCCGACTCGCCGTACCCGTCTCGCCATATCGCTTTTCAGGCAGCTGCTATGATA
ACATCAATTGTCGAAAACCTGGCCGCCCACAATGAACTTCGCTTCTGTCCGGCTTTCGTCGTGTACAGCCTTTTC
TCGGCCCTCATCATGCACGTTTACCAGATGAGATCTCCAGTTCCATCAATACAGCAAACAACTCAGGCCAGGTTA
CGGAGCTGCATGGAAGCTATGAGGGAGGTCTCTCGGGTGTGGTTGGTTGGCAAAATGGTGTATACCCTTTTTGAG
TCTATCATCGGCAACAAAATGTTGGAAGAAAGACTTCAGAAGGCCGGAACGAAGCGTCGTAGGAAGATGCCGCAA
AGCTTGTCCCAACTGGAGCATCAGACCAGGAGCAGCGACGCGTCGAAGCGGAAGTTCGATGACATCGCCATCGAT
TTCACGGCAAACGCCCCGACGCCACAGGAATCGTACGAAAGATCGCGGCCGCAGACACCAAGTACGTCGTGCAAG
AACGACGGCGGCAGCACAATGCAGCCGCCAGACCTGCCGTCGCCCGGTGCTCGTCCGGAGACTGGGACTGACGCG
TTCATGGGTGGCACCGCCTCGCGTCCGCAAACAAGGCCGGCGTCGCCGTTCTACCCTTCCCTTTCGCTACCGGCG
ACAACCCCGGATCTTTATTTGGTAACGAGAAACTCGCCCAATCTCTCGCACTCACTCTGGGAAAACTTTCAACCC
GATCAATTGTTTCCAGAAAGCTCAAGTTTGCCGGTCATCCCTAGACTGTCACCAACTCAGGCACATGATAATCTA
GATCAGGACGTCATGGCCCGTCTAACGCCCAGCAACATGGCGCCTCCCTTGCAGGGTGAACCTGCCACTTCTTTT
CCAGCAAGAGGTCAGGATCAGGGCAACGGCCTTATAAATGTGCCTGGGTTTCAGGCGCAGCCGGCCATCTGGCAT
TCCAATGTGGATCTTGGGTTGCACGACGGACAGAGTCCAGACAGTTGGAGTACTGGCTCAGCACAGGGACAGTCG
GCCCCGACGACGCTCAACGTCGAAGACTGGTTTCAATTCTTCGGTATTAATGGTGGCGACACCAATCCGCTATCC
CTCGACATACCATTGGGC
Transcript >Ophio5|8620
ATGGAGGCGGAAGTGCCCTCCGCCGTTGAGGCTGCGACGCCTCACCGTCAACCTTCACCATACTCGCTATCGAAT
TCGAAATCGCAATACAGCGAGCATCTCGAGCATGCGAGACCTGTCATGCCCGAAAGGTTCGATGCGATGCCGCTA
GCCTCGGTGTTCCCTGCACGAATTGCGTGGCCTTTCAAATCGAGTGCCGCATCCCGACGCCCAAGCGTAAGAAAC
CTGCCCACTCCGCTCCATCTCAGGCGACCAAAGATTCCGACAGTGAACGCGACTTGCTTGACGACCGACCACTAC
TGGAACCCCTTCTGTACCCACAACGGAGGCTCAATTATGAAGCCGAAGTTCACTCGTGCACCAATTACTGAAGCT
GGCAGGGTCGCATTTCTTGGCGAGTCGTCCAACTTAACCTTACTTGTTCACGACCGACAGGGCTCATCTGACGTC
GTTCACTATCCGCTTCCTGAGAATATTCGCGGCTCACGCGCCAGGCTTACGGAGCTAGACGTCGTCGAGATCGAT
ATCTTGCATCAGCGTGGGGCCTTTCTTTTACCGCCTCGTTCTTTATGCGATGAGCTAATCGACGCCTACTTCAAA
TGGGTTCACCCTATCGTTCCTGTCATAAACCGATCGCGATTTCTAAGGCAGTATCGCGACTCCACAAATCCACCA
TCCCTTTTACTTCTTCAGGCTGTTCTCCTGGCCGGCTCCCGTGTCTGCACAAATGCTCAGCTTATGGACGCAAAC
GGATCGACCAATCCCGCAGCGCTGACATTCTATAAGCGGGCCAAAGCGCTTTATGATGCCAACTACGAAGATGAC
CGCGTCACAATCGTTCAGTCCCTATTGCTACTGGGCTGGTACTGGGAAGGCCCTGAGGATGTGACCAAGAACGTG
TTCTACTGGAGCCGCGTTGCCACGATTGTTGCTCAAGGTTCCGGCATGCATCGCAGCGTGGAGCAATCGCAGCTC
AGCAAGTCCGACAAGCGGTTATGGAAGCGCATCTGGTGGACTCTTTTCACCCGCGACAGATCTGTAGCTGTTGCC
CTGGGCCGCCCGGTGCACATAAACCTGGATGACTCGGACGTTGAGATGTTAACCGAAGACGACTTTATCGAGGAC
GAACCAGATGGTGCTTGTGACCCCGCACCCGATGCAGTTCATGTCCATTTTTTCCTGCAATATGTCAAGCTTTGC
GAGATCATGGGCCTCGTGTTGTCGCAACAGTACTCAGTTGCCTCCAAAGGTCGCCAGTGGAATGCTCTTGACTTG
ACACACAGCGACATGGCACTCGCCGACTGGCTTCACAATTGCCCCAAGATCGTGTACTGGGAAATGCCTCGTCAT
CATTTCTGGTCGGCTCTTCTACACTCCAATTACTACACAACACTATGTCTTCTGCATAGGGCTCATATGCCTCCT
GGCGGCTCAGGCCGCTTACCGGCCGACTCGCCGTACCCGTCTCGCCATATCGCTTTTCAGGCAGCTGCTATGATA
ACATCAATTGTCGAAAACCTGGCCGCCCACAATGAACTTCGCTTCTGTCCGGCTTTCGTCGTGTACAGCCTTTTC
TCGGCCCTCATCATGCACGTTTACCAGATGAGATCTCCAGTTCCATCAATACAGCAAACAACTCAGGCCAGGTTA
CGGAGCTGCATGGAAGCTATGAGGGAGGTCTCTCGGGTGTGGTTGGTTGGCAAAATGGTGTATACCCTTTTTGAG
TCTATCATCGGCAACAAAATGTTGGAAGAAAGACTTCAGAAGGCCGGAACGAAGCGTCGTAGGAAGATGCCGCAA
AGCTTGTCCCAACTGGAGCATCAGACCAGGAGCAGCGACGCGTCGAAGCGGAAGTTCGATGACATCGCCATCGAT
TTCACGGCAAACGCCCCGACGCCACAGGAATCGTACGAAAGATCGCGGCCGCAGACACCAAGTACGTCGTGCAAG
AACGACGGCGGCAGCACAATGCAGCCGCCAGACCTGCCGTCGCCCGGTGCTCGTCCGGAGACTGGGACTGACGCG
TTCATGGGTGGCACCGCCTCGCGTCCGCAAACAAGGCCGGCGTCGCCGTTCTACCCTTCCCTTTCGCTACCGGCG
ACAACCCCGGATCTTTATTTGGTAACGAGAAACTCGCCCAATCTCTCGCACTCACTCTGGGAAAACTTTCAACCC
GATCAATTGTTTCCAGAAAGCTCAAGTTTGCCGGTCATCCCTAGACTGTCACCAACTCAGGCACATGATAATCTA
GATCAGGACGTCATGGCCCGTCTAACGCCCAGCAACATGGCGCCTCCCTTGCAGGGTGAACCTGCCACTTCTTTT
CCAGCAAGAGGTCAGGATCAGGGCAACGGCCTTATAAATGTGCCTGGGTTTCAGGCGCAGCCGGCCATCTGGCAT
TCCAATGTGGATCTTGGGTTGCACGACGGACAGAGTCCAGACAGTTGGAGTACTGGCTCAGCACAGGGACAGTCG
GCCCCGACGACGCTCAACGTCGAAGACTGGTTTCAATTCTTCGGTATTAATGGTGGCGACACCAATCCGCTATCC
CTCGACATACCATTGGGCTGA
Gene >Ophio5|8620
ATGGAGGCGGAAGTGCCCTCCGCCGTTGAGGCTGCGACGCCTCACCGTCAACCTTCACCATACTCGCTATCGAAT
TCGAAATCGCAATGTGAGTCGCTCGCCAAAGCGTCGCCACCTGCTGCAGGCACATCAGCTGCGCAGATGAGCTTT
AGGAGGCATGCCTGCACCTCATTCGCTCGCAATCCTATCTTATTGTCGATACTTACTGGCATCCGTCTTCTACTA
GACAGCGAGCATCTCGAGCATGCGAGGTCAGTTTAACGAGCTATTTTGTACTGATCTTCCCCGGGCGAACCCCCC
CCCCCCCAACCGAAAGAGCGAACCTGTTGATTCGGAACACGCGGCCTGCTATAGCACCAGCCTTGACTGACTACT
CACTCTAAACTATATTCATTCCGGTAGACCTGTCATGCCCGAAAGGCAAGGACACTCCCACTTGCGTATCTCATC
GGCCGGCCCTCTTGCATGCTCATACTCTCCTAGGTTCGATGCGATGCCGCTAGCCTCGGTGTTCCCTGCACGAAT
TGCGTGGCCTTTCAAATCGAGTGCCGCATCCCGACGCCCAAGCGTAAGAAACCTGCCCACTCCGCTCCATCTCAG
GCGACCAAAGATTCCGACAGGTAGAATCATCACCTTCATTCCCCTATCATTCTCTCTCTGCCCGACTGTGTCTAC
TAACGTTGGTTCGAATCTTCCTACAGTGAACGCGACTTGCTTGACGACCGACCACTACTGGTATCAGCTCCACCT
TCAATGAGCCAACAAATCCCGGCGATAACTCATAGCACTGAAGGAACCCCTTCTGTACCCACAACGGAGGCTCAA
GTCAGGCAGGAGGACTTTAACAGCAATACCTACTTGAATTTAGTTATGAAGCCGAAGTTCACTCGTGCACCAATT
ACTGAAGCTGGCAGGGTCGCATTTCTTGGCGAGTCGTCCAACTTAACCTTACTTGTTCACGACCGACAGGGCTCA
TCTGACGTCGTTCACTATCCGCTTCCTGAGAATATTCGCGGCTCACGCGCCAGGCTTACGGAGCTAGACGTCGTC
GAGATCGATATCTTGCATCAGCGTGGGGCCTTTCTTTTACCGCCTCGTTCTTTATGCGATGAGCTAATCGACGCC
TACTTCAAATGGGTTCACCCTATCGTTCCTGTCATAAACCGATCGCGATTTCTAAGGCAGTATCGCGACTCCACA
AATCCACCATCCCTTTTACTTCTTCAGGCTGTTCTCCTGGCCGGCTCCCGTGTCTGCACAAATGCTCAGCTTATG
GACGCAAACGGATCGACCAATCCCGCAGCGCTGACATTCTATAAGCGGGCCAAAGCGCTTTATGATGCCAACTAC
GAAGATGACCGCGTCACAATCGTTCAGTCCCTATTGCTACTGGGCTGGTACTGGGAAGGCCCTGAGGATGTGACC
AAGAACGTGTTCTACTGGAGCCGCGTTGCCACGATTGTTGCTCAAGGTTCCGGCATGCATCGCAGCGTGGAGCAA
TCGCAGCTCAGCAAGTCCGACAAGCGGTTATGGAAGCGCATCTGGTGGACTCTTTTCACCCGCGACAGATCTGTA
GCTGTTGCCCTGGGCCGCCCGGTGCACATAAACCTGGATGACTCGGACGTTGAGATGTTAACCGAAGACGACTTT
ATCGAGGACGAACCAGATGGTGCTTGTGACCCCGCACCCGATGCAGTTCATGTCCATTTTTTCCTGCAATATGTC
AAGCTTTGCGAGATCATGGGCCTCGTGTTGTCGCAACAGTACTCAGTTGCCTCCAAAGGTCGCCAGTGGAATGCT
CTTGACTTGACACACAGCGACATGGCACTCGCCGACTGGCTTCACAATTGCCCCAAGATCGTGTACTGGGAAATG
CCTCGTCATCATTTCTGGTCGGCTCTTCTACACTCCAATTACTACACAACACTATGTCTTCTGCATAGGGCTCAT
ATGCCTCCTGGCGGCTCAGGCCGCTTACCGGCCGACTCGCCGTACCCGTCTCGCCATATCGCTTTTCAGGCAGCT
GCTATGATAACATCAATTGTCGAAAACCTGGCCGCCCACAATGAACTTCGCTTCTGTCCGGCTTTCGTCGTGTAC
AGCCTTTTCTCGGCCCTCATCATGCACGTTTACCAGATGAGATCTCCAGTTCCATCAATACAGCAAACAACTCAG
GCCAGGTTACGGAGCTGCATGGAAGCTATGAGGGAGGTCTCTCGGGTGTGGTTGGTTGGCAAAATGGTGTATACC
CTTTTTGAGTCTATCATCGGCAACAAAATGTTGGAAGAAAGACTTCAGAAGGCCGGAACGAAGCGTCGTAGGAAG
ATGCCGCAAAGCTTGTCCCAACTGGAGCATCAGACCAGGAGCAGCGACGCGTCGAAGCGGAAGTTCGATGACATC
GCCATCGATTTCACGGCAAACGCCCCGACGCCACAGGAATCGTACGAAAGATCGCGGCCGCAGACACCAAGTACG
TCGTGCAAGAACGACGGCGGCAGCACAATGCAGCCGCCAGACCTGCCGTCGCCCGGTGCTCGTCCGGAGACTGGG
ACTGACGCGTTCATGGGTGGCACCGCCTCGCGTCCGCAAACAAGGCCGGCGTCGCCGTTCTACCCTTCCCTTTCG
CTACCGGCGACAACCCCGGATCTTTATTTGGTAACGAGAAACTCGCCCAATCTCTCGCACTCACTCTGGGAAAAC
TTTCAACCCGATCAATTGTTTCCAGAAAGCTCAAGTTTGCCGGTCATCCCTAGACTGTCACCAACTCAGGCACAT
GATAATCTAGATCAGGACGTCATGGCCCGTCTAACGCCCAGCAACATGGCGCCTCCCTTGCAGGGTGAACCTGCC
ACTTCTTTTCCAGCAAGAGGTCAGGATCAGGGCAACGGCCTTATAAATGTGCCTGGGTTTCAGGCGCAGCCGGCC
ATCTGGCATTCCAATGTGGATCTTGGGTTGCACGACGGACAGAGTCCAGACAGTTGGAGTACTGGCTCAGCACAG
GGACAGTCGGCCCCGACGACGCTCAACGTCGAAGACTGGTATAGCCATCTTGGTCAAATGTTCTGTCGTGTCTTG
GCTAACGATAGGCTAGGTTTCAATTCTTCGGTATTAATGGTGGCGACACCAATCCGCTATCCCTCGACATACCAT
TGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail