Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|862
Gene name
Locationscaffold_1251:830..1614
Strand+
Gene length (bp)784
Transcript length (bp)696
Coding sequence length (bp)693
Protein length (aa) 231

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.7337 0.5713 0.0299 0.1215 0.0993 0.0053 0.065 0.0944 0.1708 0.1165

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6146
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3321
Ophiocordyceps australis map64 (Brazil) OphauB2|2490
Ophiocordyceps camponoti-rufipedis Ophun1|2097
Ophiocordyceps kimflemingae Ophio5|862 (this protein)
Ophiocordyceps subramaniannii Hirsu2|4709

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|862
MSKNSSPLSIDTDDKKSANPEKMTCPLAISSSFKKITSGRNPFFASEIVSSNLLRQDATPSSTADFQETSGVEDV
EQTERRRNEYRNVPKLDRTMTDIYGDELYSPNFAITSTSPLPNHTPTSPSNDLFSQRINAANSQHLTAAHSPVST
STRNRSPFRTCSPFASSTSHATWPPVNTSQRTSDQSTLDRETSSIRQSEQCTLVNVDNEPETPKTISPKDAILEL
NEADEP
Coding >Ophio5|862
ATGTCCAAGAACTCTTCACCATTGTCCATTGATACAGACGACAAAAAGAGCGCCAACCCCGAGAAGATGACTTGT
CCATTGGCAATATCCAGTTCCTTTAAGAAAATTACCTCGGGCCGAAACCCCTTTTTTGCTTCCGAAATAGTGAGC
AGTAATCTGCTTCGCCAAGACGCTACGCCAAGTTCTACTGCAGATTTTCAGGAGACATCTGGGGTGGAGGACGTC
GAACAGACTGAGCGGAGGAGGAATGAATATCGCAATGTCCCGAAGTTGGATCGAACAATGACGGACATCTACGGT
GATGAGCTGTACAGTCCAAATTTCGCCATCACGTCGACGTCTCCACTGCCCAACCACACACCAACATCACCCAGC
AACGATCTTTTTAGTCAACGGATCAATGCTGCCAATAGCCAACATTTGACCGCTGCGCATTCCCCTGTATCGACA
TCCACCAGAAATCGATCTCCATTTCGAACATGCTCACCTTTTGCTTCATCCACGTCTCATGCAACCTGGCCTCCG
GTCAACACATCGCAGCGGACGTCGGATCAAAGTACTTTGGACCGAGAAACATCGTCTATACGGCAGTCCGAGCAG
TGCACTCTTGTCAACGTTGATAATGAGCCGGAGACTCCTAAAACAATATCTCCCAAAGACGCTATTCTGGAGCTT
AACGAGGCTGACGAGCCT
Transcript >Ophio5|862
ATGTCCAAGAACTCTTCACCATTGTCCATTGATACAGACGACAAAAAGAGCGCCAACCCCGAGAAGATGACTTGT
CCATTGGCAATATCCAGTTCCTTTAAGAAAATTACCTCGGGCCGAAACCCCTTTTTTGCTTCCGAAATAGTGAGC
AGTAATCTGCTTCGCCAAGACGCTACGCCAAGTTCTACTGCAGATTTTCAGGAGACATCTGGGGTGGAGGACGTC
GAACAGACTGAGCGGAGGAGGAATGAATATCGCAATGTCCCGAAGTTGGATCGAACAATGACGGACATCTACGGT
GATGAGCTGTACAGTCCAAATTTCGCCATCACGTCGACGTCTCCACTGCCCAACCACACACCAACATCACCCAGC
AACGATCTTTTTAGTCAACGGATCAATGCTGCCAATAGCCAACATTTGACCGCTGCGCATTCCCCTGTATCGACA
TCCACCAGAAATCGATCTCCATTTCGAACATGCTCACCTTTTGCTTCATCCACGTCTCATGCAACCTGGCCTCCG
GTCAACACATCGCAGCGGACGTCGGATCAAAGTACTTTGGACCGAGAAACATCGTCTATACGGCAGTCCGAGCAG
TGCACTCTTGTCAACGTTGATAATGAGCCGGAGACTCCTAAAACAATATCTCCCAAAGACGCTATTCTGGAGCTT
AACGAGGCTGACGAGCCTTGA
Gene >Ophio5|862
ATGTCCAAGAACTCTTCACCATTGTCCATTGATACAGACGACAAAAAGAGCGCCAACCCCGAGAAGATGACTTGT
CCATTGGCAATATCCAGTTCCTTTAAGAAAATTACCTCGGGCCGAAACCCCTTTTTTGCTTCCGAAATAGTGAGC
AGTAATCTGCTTCGCCAAGACGCTACGCCAAGTTCTACTGCAGATTTTCAGGAGACATCTGGGGTGGAGGACGTC
GAACAGACTGAGCGGAGGAGGAATGGTAGGTGACCACTCCTAGCTATCTGTTGATCAAGCCTCACAGCATGTCTA
GAATATCGCAATGTCCCGAAGTTGGATCGAACAATGACGGACATCTACGGTGATGAGCTGTACAGTCCAAATTTC
GCCATCACGTCGACGTCTCCACTGCCCAACCACACACCAACATCACCCAGCAACGATCTTTTTAGTCAACGGATC
AATGCTGCCAATAGCCAACATTTGACCGCTGCGCATTCCCCTGTATCGACATCCACCAGAAATCGATCTCCATTT
CGAACATGCTCACCTTTTGCTTCATCCACGTCTCATGCAACCTGGCCTCCGGTCAACACATCGCAGCGGACGTCG
GATCAAAGTACTTTGGACCGAGAAACATCGTCTATACGGCAGTCCGAGCAGTGCACTCTTGTCAACGTTGATAAT
GAGCCGGAGACTCCTAAAACAATATCTCCCAAAGACGCTATTCTGGAGCTTAACGAGGCTGACGTAGATGGGAAT
TTCCCCCTATTTCCGCAGGACGCAGGAGCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail