Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8617
Gene name
Locationscaffold_992:983..3659
Strand+
Gene length (bp)2676
Transcript length (bp)1977
Coding sequence length (bp)1977
Protein length (aa) 659

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04059 RRM_2 RNA recognition motif 2 7.8E-39 462 558

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P08965|MEI2_SCHPO Meiosis protein mei2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mei2 PE=1 SV=1 447 619 2.0E-52
sp|Q64M78|OML4_ORYSJ Protein MEI2-like 4 OS=Oryza sativa subsp. japonica GN=ML4 PE=2 SV=1 381 592 2.0E-36
sp|Q6ZI17|OML2_ORYSJ Protein MEI2-like 2 OS=Oryza sativa subsp. japonica GN=ML2 PE=2 SV=1 378 592 3.0E-36
sp|Q8W4I9|AML1_ARATH Protein MEI2-like 1 OS=Arabidopsis thaliana GN=ML1 PE=1 SV=1 450 596 4.0E-35
sp|Q75M35|OML3_ORYSJ Protein MEI2-like 3 OS=Oryza sativa subsp. japonica GN=ML3 PE=2 SV=2 450 596 4.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P08965|MEI2_SCHPO Meiosis protein mei2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mei2 PE=1 SV=1 447 619 2.0E-52
sp|Q64M78|OML4_ORYSJ Protein MEI2-like 4 OS=Oryza sativa subsp. japonica GN=ML4 PE=2 SV=1 381 592 2.0E-36
sp|Q6ZI17|OML2_ORYSJ Protein MEI2-like 2 OS=Oryza sativa subsp. japonica GN=ML2 PE=2 SV=1 378 592 3.0E-36
sp|Q8W4I9|AML1_ARATH Protein MEI2-like 1 OS=Arabidopsis thaliana GN=ML1 PE=1 SV=1 450 596 4.0E-35
sp|Q75M35|OML3_ORYSJ Protein MEI2-like 3 OS=Oryza sativa subsp. japonica GN=ML3 PE=2 SV=2 450 596 4.0E-35
sp|Q9LYN7|AML4_ARATH Protein MEI2-like 4 OS=Arabidopsis thaliana GN=ML4 PE=2 SV=1 425 596 6.0E-35
sp|Q8VWF5|AML5_ARATH Protein MEI2-like 5 OS=Arabidopsis thaliana GN=ML5 PE=1 SV=1 364 580 1.0E-33
sp|Q6EQX3|OML5_ORYSJ Protein MEI2-like 5 OS=Oryza sativa subsp. japonica GN=ML5 PE=2 SV=1 450 574 5.0E-32
sp|Q9SVV9|AML3_ARATH Protein MEI2-like 3 OS=Arabidopsis thaliana GN=ML3 PE=2 SV=2 450 582 3.0E-30
sp|Q9SJG8|AML2_ARATH Protein MEI2-like 2 OS=Arabidopsis thaliana GN=ML2 PE=2 SV=2 436 579 1.0E-26
sp|Q0JGS5|EAR1_ORYSJ Protein terminal ear1 homolog OS=Oryza sativa subsp. japonica GN=PLA2 PE=2 SV=1 460 574 2.0E-21
sp|A2WY46|EAR1_ORYSI Protein terminal ear1 homolog OS=Oryza sativa subsp. indica GN=PLA2 PE=2 SV=1 460 574 2.0E-21
sp|O65001|TE1_MAIZE Protein terminal ear1 OS=Zea mays GN=TE1 PE=2 SV=1 459 594 3.0E-21
sp|Q6ET49|OML7_ORYSJ Protein MEI2-like 7 OS=Oryza sativa subsp. japonica GN=OML7 PE=2 SV=1 463 574 3.0E-12
sp|Q652K6|OML6_ORYSJ Protein MEI2-like 6 OS=Oryza sativa subsp. japonica GN=ML6 PE=2 SV=1 463 574 6.0E-09
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.8069 0.69 0.0815 0.0444 0.117 0.0007 0.0987 0.0639 0.0362 0.017

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4981
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7951
Ophiocordyceps australis map64 (Brazil) OphauB2|4669
Ophiocordyceps camponoti-floridani Ophcf2|04256
Ophiocordyceps camponoti-rufipedis Ophun1|4716
Ophiocordyceps kimflemingae Ophio5|8617 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2180

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8617
MAQDRDIENPSSPRSSSGGADSFKGTPDTRLTTFSPDNTSSSKHLSGLTRPFSTTSPGNLPASAYSSAVSHLEKD
PFVTPSSNRLGTRLSPTALAFSPFPAVKNTSFTGEGGPIATALSEELGLSRDLDVSSIIPISISEISTVLNELET
DGEPPHGTRCFDTVDGNILISFTDIRDACSALASLRVAEKSWEVQYADQAQCPEGTRISLSTVCNPGKILVSAAV
PQGTTLDVLQAMDIARGLLQAHGQLFAFVGQSIFPDGSFKAIAEFCNVTAAIHAASNLNNLVTNEGIHFVFSPYT
STTTQVPALMDAIHGLGISQSHGELQPQQTLGPSTITGARASQGMRIQSPFAMYPLMVQSPFASGMPCMYDSFFP
ATAQGTVTPLAPMSPSFAGVGSLYNSPPSPALTVQKNYSPCRPIPGFGRSEARRQNAMRISRSSHHSVTGHHNHV
DINRIRDGIDVRTTIMLRNIPNKVDQSMLKRIIDESSWGKYDFMYLRIDFANDCNVGYAFINFVDPLDIIDFVDA
RGNQRWNCFKSDKVAEISYATIQGKDCLVQKFRNSSVMLEAPHYRPKLYFTSNGPMPELAGQEESFPEPDNQSKM
KRSCENAEHVGLFTPNAGQHFRDEQRRRRSQYDRGTRLAALEEYDYEAAIQHLYGTTK*
Coding >Ophio5|8617
ATGGCACAGGACCGCGACATCGAGAACCCATCATCGCCCAGGTCGTCGAGCGGCGGAGCGGATTCATTCAAAGGA
ACGCCAGATACGCGTCTGACGACATTTTCGCCCGACAATACCTCCTCGTCTAAGCACCTATCAGGTCTTACGCGT
CCTTTCTCTACCACGTCCCCTGGCAACCTGCCAGCGAGTGCCTACAGCAGTGCTGTCTCTCATTTGGAAAAGGAC
CCGTTCGTCACACCTTCTTCAAATCGTCTTGGAACCAGACTATCACCCACTGCGCTGGCGTTCAGTCCATTTCCC
GCGGTGAAAAACACTTCCTTCACTGGTGAAGGCGGCCCGATTGCGACAGCCCTCAGCGAAGAGTTGGGCCTCTCT
CGGGACCTTGATGTTTCTTCGATCATTCCCATCTCGATCTCGGAAATCAGTACTGTGCTTAATGAACTGGAGACT
GACGGAGAGCCCCCTCATGGAACCCGCTGTTTTGACACCGTTGATGGGAACATTCTGATATCCTTTACGGATATC
AGGGATGCATGTTCAGCGCTTGCCAGCCTCCGCGTTGCGGAGAAGAGCTGGGAGGTTCAGTACGCCGACCAGGCT
CAATGTCCTGAGGGAACCAGGATTTCCTTGTCAACAGTATGCAACCCTGGTAAAATTCTTGTATCAGCCGCCGTG
CCACAGGGCACCACTCTCGATGTCCTTCAGGCCATGGACATCGCACGGGGTCTTTTGCAAGCGCACGGCCAGCTA
TTCGCTTTTGTAGGCCAGTCGATCTTTCCAGATGGCTCGTTCAAGGCCATCGCAGAGTTTTGCAACGTGACAGCT
GCCATCCACGCGGCTTCGAACCTGAATAACTTGGTCACTAACGAGGGAATCCATTTCGTCTTCTCTCCATACACG
TCCACCACGACTCAGGTTCCCGCCCTGATGGATGCAATTCATGGCCTTGGCATCAGTCAAAGCCATGGCGAATTA
CAACCACAGCAGACATTAGGTCCTTCAACTATTACTGGCGCAAGAGCTTCTCAAGGGATGCGGATTCAGTCTCCA
TTCGCCATGTACCCGCTCATGGTCCAGTCGCCCTTTGCCTCTGGCATGCCTTGCATGTACGATTCGTTCTTCCCA
GCTACCGCGCAAGGAACCGTAACTCCTCTCGCTCCAATGTCGCCGTCATTCGCCGGTGTCGGCTCTCTTTATAAC
TCACCACCGTCGCCAGCCCTGACGGTTCAGAAGAATTACAGTCCGTGCAGACCAATACCTGGCTTTGGCAGGTCA
GAGGCCCGCAGGCAGAATGCCATGCGTATTAGTCGATCATCACATCATAGTGTGACGGGTCATCACAATCACGTT
GACATCAACCGAATTCGTGACGGCATTGACGTTCGCACCACGATAATGCTTCGAAATATACCGAACAAAGTCGAC
CAATCAATGCTCAAGCGGATCATTGATGAATCCAGCTGGGGCAAGTACGACTTCATGTACCTGCGAATTGATTTC
GCCAACGACTGCAACGTTGGCTACGCATTTATCAATTTCGTCGATCCATTAGATATCATAGATTTCGTCGATGCG
CGCGGTAACCAGCGTTGGAACTGCTTCAAAAGTGACAAGGTTGCAGAGATCTCCTATGCCACCATTCAAGGTAAA
GATTGTTTGGTGCAAAAGTTTCGCAACAGCTCCGTTATGCTGGAGGCACCTCATTATCGACCGAAGCTCTACTTT
ACATCCAACGGCCCGATGCCGGAGCTGGCAGGCCAAGAGGAGTCATTTCCAGAGCCAGATAACCAGTCGAAAATG
AAGAGAAGTTGCGAGAATGCAGAGCACGTCGGCCTTTTTACACCCAATGCCGGCCAGCATTTTCGAGATGAGCAA
CGTCGTAGGCGATCTCAATATGACCGGGGAACTCGACTGGCTGCTCTCGAGGAGTACGACTACGAGGCAGCTATA
CAGCACCTCTACGGCACAACAAAGTAA
Transcript >Ophio5|8617
ATGGCACAGGACCGCGACATCGAGAACCCATCATCGCCCAGGTCGTCGAGCGGCGGAGCGGATTCATTCAAAGGA
ACGCCAGATACGCGTCTGACGACATTTTCGCCCGACAATACCTCCTCGTCTAAGCACCTATCAGGTCTTACGCGT
CCTTTCTCTACCACGTCCCCTGGCAACCTGCCAGCGAGTGCCTACAGCAGTGCTGTCTCTCATTTGGAAAAGGAC
CCGTTCGTCACACCTTCTTCAAATCGTCTTGGAACCAGACTATCACCCACTGCGCTGGCGTTCAGTCCATTTCCC
GCGGTGAAAAACACTTCCTTCACTGGTGAAGGCGGCCCGATTGCGACAGCCCTCAGCGAAGAGTTGGGCCTCTCT
CGGGACCTTGATGTTTCTTCGATCATTCCCATCTCGATCTCGGAAATCAGTACTGTGCTTAATGAACTGGAGACT
GACGGAGAGCCCCCTCATGGAACCCGCTGTTTTGACACCGTTGATGGGAACATTCTGATATCCTTTACGGATATC
AGGGATGCATGTTCAGCGCTTGCCAGCCTCCGCGTTGCGGAGAAGAGCTGGGAGGTTCAGTACGCCGACCAGGCT
CAATGTCCTGAGGGAACCAGGATTTCCTTGTCAACAGTATGCAACCCTGGTAAAATTCTTGTATCAGCCGCCGTG
CCACAGGGCACCACTCTCGATGTCCTTCAGGCCATGGACATCGCACGGGGTCTTTTGCAAGCGCACGGCCAGCTA
TTCGCTTTTGTAGGCCAGTCGATCTTTCCAGATGGCTCGTTCAAGGCCATCGCAGAGTTTTGCAACGTGACAGCT
GCCATCCACGCGGCTTCGAACCTGAATAACTTGGTCACTAACGAGGGAATCCATTTCGTCTTCTCTCCATACACG
TCCACCACGACTCAGGTTCCCGCCCTGATGGATGCAATTCATGGCCTTGGCATCAGTCAAAGCCATGGCGAATTA
CAACCACAGCAGACATTAGGTCCTTCAACTATTACTGGCGCAAGAGCTTCTCAAGGGATGCGGATTCAGTCTCCA
TTCGCCATGTACCCGCTCATGGTCCAGTCGCCCTTTGCCTCTGGCATGCCTTGCATGTACGATTCGTTCTTCCCA
GCTACCGCGCAAGGAACCGTAACTCCTCTCGCTCCAATGTCGCCGTCATTCGCCGGTGTCGGCTCTCTTTATAAC
TCACCACCGTCGCCAGCCCTGACGGTTCAGAAGAATTACAGTCCGTGCAGACCAATACCTGGCTTTGGCAGGTCA
GAGGCCCGCAGGCAGAATGCCATGCGTATTAGTCGATCATCACATCATAGTGTGACGGGTCATCACAATCACGTT
GACATCAACCGAATTCGTGACGGCATTGACGTTCGCACCACGATAATGCTTCGAAATATACCGAACAAAGTCGAC
CAATCAATGCTCAAGCGGATCATTGATGAATCCAGCTGGGGCAAGTACGACTTCATGTACCTGCGAATTGATTTC
GCCAACGACTGCAACGTTGGCTACGCATTTATCAATTTCGTCGATCCATTAGATATCATAGATTTCGTCGATGCG
CGCGGTAACCAGCGTTGGAACTGCTTCAAAAGTGACAAGGTTGCAGAGATCTCCTATGCCACCATTCAAGGTAAA
GATTGTTTGGTGCAAAAGTTTCGCAACAGCTCCGTTATGCTGGAGGCACCTCATTATCGACCGAAGCTCTACTTT
ACATCCAACGGCCCGATGCCGGAGCTGGCAGGCCAAGAGGAGTCATTTCCAGAGCCAGATAACCAGTCGAAAATG
AAGAGAAGTTGCGAGAATGCAGAGCACGTCGGCCTTTTTACACCCAATGCCGGCCAGCATTTTCGAGATGAGCAA
CGTCGTAGGCGATCTCAATATGACCGGGGAACTCGACTGGCTGCTCTCGAGGAGTACGACTACGAGGCAGCTATA
CAGCACCTCTACGGCACAACAAAGTAA
Gene >Ophio5|8617
ATGGCACAGGACCGCGACATCGAGAACCCATCATCGCCCAGGTCGTCGAGCGGCGGAGCGGATTCATTCAAAGGA
ACGCCAGATACGCGTCTGACGACATTTTCGCCCGACAATACCTCCTCGTCTAAGCACCTATCAGGTCTTACGCGT
CCTTTCTCTACCACGTCCCCTGGCAACCTGCCAGCGAGTGCCTACAGCAGTGCTGTCTCTCATTTGGAAAAGGAC
CCGTTCGTCACACCTTCTTCAAATCGTCTTGGAACCAGACTATCACCCACTGCGCTGGCGTTCAGTCCATTTCCC
GCGGTGAAAAACACTTCCTTCACTGGTGAAGGCGGCCCGATTGCGACAGCCCTCAGCGAAGAGTTGGGCCTCTCT
CGGGACCTTGATGTTTCTTCGATCATTCCCATCTCGATCTCGGAAATCAGTACTGTGCTTAATGTCTGTGTGCAT
CTGCCGTCTGTCATTTGAATGTTTTTCATTTTGATCTGACCTTTATTGTAGGAACTGGAGACTGACGGAGAGCCC
CCTCATGGAACCCGCTGTTTTGACACCGTTGATGGGAACATTCTGATATCCTTTACGGATATCAGGGATGCATGT
TCAGCGCTTGCCAGCCTCCGCGTTGCGGAGAAGAGCTGGGAGGTTCAGTACGCCGACCAGGCTCAATGTCCTGAG
GTGGGTGCTCCTTCTTTTCTTCAAAATCGCCTCAACCTTTCAACAGGCTAACAGATGTTCCCGTCTCCCAAGGGA
ACCAGGATTTCCTTGTCAACAGTATGCAACCCTGGTAAAATTCTTGTATCAGCCGCCGTGCCACAGGGCACCACT
CTCGATGTCCTTCAGGCCATGGACATCGCACGGGGTCTTTTGCAAGCGCACGGCCAGCTATTCGCTTTTGTAGGC
CAGTCGATCTTTCCAGATGGCTCGTTCAAGGCCATCGCAGAGTTTTGCAACGTGACAGCTGCCATCCACGCGGCT
TCGAACCTGAATAACTTGGTCACTAACGAGGCAAGTCTGCGCAAATGCGCGCCTGCTCGCCGGCGGATAACTAAC
CTCGTTCCTAGGGAATCCATTTCGTCTTCTCTCCATACACGTCCACCACGACTCAGGTTCCCGCCCTGATGGATG
CAATTCATGGCCTTGGCATCAGTCAAAGCCATGGCGAATTACAACCACAGCAGACATTAGGTCCTTCAACTATTA
CTGGCGCAAGAGCTTCTCAAGGGATGCGGATTCAGTCTCCATTCGCCATGTACCCGCTCATGGTCCAGTCGCCCT
TTGCCTCTGGCATGCCTTGCATGTACGATTCGTTCTTCCCAGCTACCGCGCAAGGAACCGTAACTCCTCTCGCTC
CAATGTCGCCGTCATTCGCCGGTGTCGGCTCTCTTTATAACTCACCACCGTCGCCAGCCCTGACGGTTCAGAAGA
ATTACAGTCCGTGCAGACCAATACCTGGCTTTGGCAGGTCAGAGGCCCGCAGGCAGAATGCCATGCGTATTAGTC
GATCATCACATCATAGTGTGACGGGTCATCACAATCACGTTGACATCAACCGAATTCGTGACGGCATTGACGTTC
GCACCACGGTACGTCCTGCCGTTCCTGTATAAGGCTCATTAGTCCAACAAGTCCCAGATAATGCTTCGAAATATA
CCGAACAAAGTCGACCAATCAATGCTCAAGCGGATCATTGATGAATCCAGCTGGGGCAAGTACGACTTCATGTAC
CTGCGAATTGATTTCGCCAACGACTGCAAGTGAGTCTTTCACTCGGTGGCAGTGCCTTTGGCTCGACCACGGACC
AAATGCTGATGCCTTCTGGTGCCTGCAAAGCGTTGGCTACGCATTTATCAATTTCGTCGATGTGAGTCCTCCAGT
CCCTCCGCTCAATTTTTCTTTCTGAAAAAGGACCTCGGACCGATGCTAACGGCACTCAAAGCCATTAGATATCAT
AGATGTAACTTTCCCCAACACCAATCCGCGGGTGAAGCAAGCTGACAATTGACAGTTCGTCGATGCGCGCGGTAA
CCAGCGTTGGTAAGTAATGGCCAACTAGCGAAGTCTGCCAGTCACTAAATAGCACTCAGGAACTGCTTCAAAAGT
GACAAGGTTGCAGAGATCTCCTATGCCAGTAGGTGGAGTCTGCATTGCTTCCTGTGCTTCGTACGAGGGACTGAT
GTAGGCATCAGCCATTCAAGGTAAAGATTGTTTGGTGCAAAAGTTTCGCAACAGCTCCGTTATGCTGGAGGCACC
TCATTATCGACCGAAGGTATGTCCGGTCTCAAAAATAATCACAGCCTTGCGTGGCAAACCAAGAGGCGCGAATCC
GTGGGCTTTGCTAAGTGGTGCAGCTCTACTTTACATCCAACGGCCCGATGCCGGAGCTGGCAGGCCAAGAGGAGT
CATTTCCAGAGCCAGATAACCAGTCGAAAATGAAGAGAAGTTGCGAGAATGCAGAGCACGTCGGCAAGTGATCTT
TGGCTTACACATCTCAACTCCGACCGACATGGGGCAAAAGCTCATTCTCTGACAGGCCTTTTTACACCCAATGCC
GGCCAGCATTTTCGAGATGAGCAACGTCGTAGGCGATCTCAATATGACCGGGGAACTCGACTGGCTGCTCTCGAG
GAGTACGACTACGAGGCAGCTATACAGCACCTCTACGGCACAACAAAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail