Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8615
Gene name
Locationscaffold_991:2626..3160
Strand+
Gene length (bp)534
Transcript length (bp)534
Coding sequence length (bp)531
Protein length (aa) 177

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 27 49 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 52.18 22.76 81.60
CcL In ants, during behavior modification 29.40 10.72 48.07
CcD In ants, recently dead 32.88 12.54 53.22

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.051166 no
SC16a CcD 0.129531 no
CcL CcD 0.762825 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8615
MSHTHGKHGRHRSDMGGDGGLAAPQPLLWVLVPLLAVFAAGCLFFWLWTRRQRRRRRRRRRRPGDEATTARSWPD
VHGGGAATARGGGSRPWGSGVWGAGNEMEEGLDERGEAPPPYEAKSPSPTVRPPEYVASPASSHLARPPSPPPPP
PPPPPTAMGTPPSPPEASWPRPPRRGG
Coding >Ophio5|8615
ATGAGCCACACGCACGGCAAACACGGCAGGCATCGGAGCGATATGGGCGGAGACGGCGGCTTGGCGGCGCCGCAA
CCGCTGTTGTGGGTCTTGGTGCCGCTGCTCGCCGTCTTTGCTGCCGGCTGCCTCTTCTTCTGGCTATGGACCCGA
CGGCAGCGAAGACGGAGGCGGAGACGGAGGCGGCGACCGGGCGATGAAGCGACAACTGCGCGGAGCTGGCCGGAT
GTACACGGCGGCGGTGCGGCCACGGCCCGCGGGGGAGGCAGCCGGCCGTGGGGTTCAGGAGTTTGGGGAGCCGGT
AATGAGATGGAGGAGGGTCTCGACGAACGGGGAGAGGCGCCGCCTCCGTACGAGGCTAAGAGCCCGTCACCAACG
GTGCGGCCTCCCGAGTATGTGGCGTCGCCTGCATCGTCACATTTAGCACGACCGCCGTCTCCGCCGCCGCCTCCG
CCTCCCCCTCCTCCAACTGCGATGGGAACGCCTCCATCACCGCCCGAAGCATCATGGCCGCGACCTCCTCGGCGG
GGCGGG
Transcript >Ophio5|8615
ATGAGCCACACGCACGGCAAACACGGCAGGCATCGGAGCGATATGGGCGGAGACGGCGGCTTGGCGGCGCCGCAA
CCGCTGTTGTGGGTCTTGGTGCCGCTGCTCGCCGTCTTTGCTGCCGGCTGCCTCTTCTTCTGGCTATGGACCCGA
CGGCAGCGAAGACGGAGGCGGAGACGGAGGCGGCGACCGGGCGATGAAGCGACAACTGCGCGGAGCTGGCCGGAT
GTACACGGCGGCGGTGCGGCCACGGCCCGCGGGGGAGGCAGCCGGCCGTGGGGTTCAGGAGTTTGGGGAGCCGGT
AATGAGATGGAGGAGGGTCTCGACGAACGGGGAGAGGCGCCGCCTCCGTACGAGGCTAAGAGCCCGTCACCAACG
GTGCGGCCTCCCGAGTATGTGGCGTCGCCTGCATCGTCACATTTAGCACGACCGCCGTCTCCGCCGCCGCCTCCG
CCTCCCCCTCCTCCAACTGCGATGGGAACGCCTCCATCACCGCCCGAAGCATCATGGCCGCGACCTCCTCGGCGG
GGCGGGTGA
Gene >Ophio5|8615
ATGAGCCACACGCACGGCAAACACGGCAGGCATCGGAGCGATATGGGCGGAGACGGCGGCTTGGCGGCGCCGCAA
CCGCTGTTGTGGGTCTTGGTGCCGCTGCTCGCCGTCTTTGCTGCCGGCTGCCTCTTCTTCTGGCTATGGACCCGA
CGGCAGCGAAGACGGAGGCGGAGACGGAGGCGGCGACCGGGCGATGAAGCGACAACTGCGCGGAGCTGGCCGGAT
GTACACGGCGGCGGTGCGGCCACGGCCCGCGGGGGAGGCAGCCGGCCGTGGGGTTCAGGAGTTTGGGGAGCCGGT
AATGAGATGGAGGAGGGTCTCGACGAACGGGGAGAGGCGCCGCCTCCGTACGAGGCTAAGAGCCCGTCACCAACG
GTGCGGCCTCCCGAGTATGTGGCGTCGCCTGCATCGTCACATTTAGCACGACCGCCGTCTCCGCCGCCGCCTCCG
CCTCCCCCTCCTCCAACTGCGATGGGAACGCCTCCATCACCGCCCGAAGCATCATGGCCGCGACCTCCTCGGCGG
GGCGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail