Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8614
Gene name
Locationscaffold_991:657..2316
Strand+
Gene length (bp)1659
Transcript length (bp)1545
Coding sequence length (bp)1542
Protein length (aa) 514

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase 1.4E-10 305 478

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q28612|UD14_RABIT UDP-glucuronosyltransferase 1-4 OS=Oryctolagus cuniculus GN=UGT1 PE=2 SV=1 265 478 6.0E-09
sp|Q6ZQM8|UD17C_MOUSE UDP-glucuronosyltransferase 1-7C OS=Mus musculus GN=Ugt1a7c PE=1 SV=1 265 478 6.0E-09
sp|Q28611|UD16_RABIT UDP-glucuronosyltransferase 1-6 OS=Oryctolagus cuniculus GN=UGT1 PE=1 SV=1 308 478 8.0E-09
sp|P70691|UD12_MOUSE UDP-glucuronosyltransferase 1-2 OS=Mus musculus GN=Ugt1a2 PE=1 SV=1 265 478 8.0E-09
sp|Q63886|UD11_MOUSE UDP-glucuronosyltransferase 1-1 OS=Mus musculus GN=Ugt1a1 PE=1 SV=2 266 478 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q28612|UD14_RABIT UDP-glucuronosyltransferase 1-4 OS=Oryctolagus cuniculus GN=UGT1 PE=2 SV=1 265 478 6.0E-09
sp|Q6ZQM8|UD17C_MOUSE UDP-glucuronosyltransferase 1-7C OS=Mus musculus GN=Ugt1a7c PE=1 SV=1 265 478 6.0E-09
sp|Q28611|UD16_RABIT UDP-glucuronosyltransferase 1-6 OS=Oryctolagus cuniculus GN=UGT1 PE=1 SV=1 308 478 8.0E-09
sp|P70691|UD12_MOUSE UDP-glucuronosyltransferase 1-2 OS=Mus musculus GN=Ugt1a2 PE=1 SV=1 265 478 8.0E-09
sp|Q63886|UD11_MOUSE UDP-glucuronosyltransferase 1-1 OS=Mus musculus GN=Ugt1a1 PE=1 SV=2 266 478 1.0E-08
sp|Q64676|CGT_MOUSE 2-hydroxyacylsphingosine 1-beta-galactosyltransferase OS=Mus musculus GN=Ugt8 PE=1 SV=2 265 478 2.0E-08
sp|Q09426|CGT_RAT 2-hydroxyacylsphingosine 1-beta-galactosyltransferase OS=Rattus norvegicus GN=Ugt8 PE=2 SV=1 265 478 3.0E-08
sp|Q64435|UD16_MOUSE UDP-glucuronosyltransferase 1-6 OS=Mus musculus GN=Ugt1a6 PE=1 SV=1 308 478 3.0E-08
sp|Q64550|UD11_RAT UDP-glucuronosyltransferase 1-1 OS=Rattus norvegicus GN=Ugt1a1 PE=1 SV=1 308 478 3.0E-08
sp|O22183|U84B2_ARATH UDP-glycosyltransferase 84B2 OS=Arabidopsis thaliana GN=UGT84B2 PE=3 SV=1 275 451 3.0E-08
sp|Q9HAW9|UD18_HUMAN UDP-glucuronosyltransferase 1-8 OS=Homo sapiens GN=UGT1A8 PE=1 SV=1 228 478 4.0E-08
sp|Q16880|CGT_HUMAN 2-hydroxyacylsphingosine 1-beta-galactosyltransferase OS=Homo sapiens GN=UGT8 PE=2 SV=2 265 478 5.0E-08
sp|Q64638|UD15_RAT UDP-glucuronosyltransferase 1-5 OS=Rattus norvegicus GN=Ugt1a5 PE=2 SV=1 265 478 5.0E-08
sp|Q63ZR6|UD3A1_XENLA UDP-glucuronosyltransferase 3A1 OS=Xenopus laevis GN=ugt3a1 PE=2 SV=1 132 472 5.0E-08
sp|P35504|UD15_HUMAN UDP-glucuronosyltransferase 1-5 OS=Homo sapiens GN=UGT1A5 PE=2 SV=1 265 478 5.0E-08
sp|P19224|UD16_HUMAN UDP-glucuronosyltransferase 1-6 OS=Homo sapiens GN=UGT1A6 PE=1 SV=2 265 478 6.0E-08
sp|Q9HAW8|UD110_HUMAN UDP-glucuronosyltransferase 1-10 OS=Homo sapiens GN=UGT1A10 PE=1 SV=1 265 478 6.0E-08
sp|Q62452|UD19_MOUSE UDP-glucuronosyltransferase 1-9 OS=Mus musculus GN=Ugt1a9 PE=1 SV=3 308 478 6.0E-08
sp|O60656|UD19_HUMAN UDP-glucuronosyltransferase 1-9 OS=Homo sapiens GN=UGT1A9 PE=1 SV=1 265 478 6.0E-08
sp|P08430|UD16_RAT UDP-glucuronosyltransferase 1-6 OS=Rattus norvegicus GN=Ugt1a6 PE=1 SV=1 307 478 8.0E-08
sp|Q64634|UD18_RAT UDP-glucuronosyltransferase 1-8 OS=Rattus norvegicus GN=Ugt1a8 PE=2 SV=1 265 478 8.0E-08
sp|P20720|UD12_RAT UDP-glucuronosyltransferase 1-2 OS=Rattus norvegicus GN=Ugt1a2 PE=2 SV=2 308 478 9.0E-08
sp|O22182|U84B1_ARATH UDP-glycosyltransferase 84B1 OS=Arabidopsis thaliana GN=UGT84B1 PE=2 SV=1 275 476 9.0E-08
sp|P22310|UD14_HUMAN UDP-glucuronosyltransferase 1-4 OS=Homo sapiens GN=UGT1A4 PE=1 SV=1 265 478 9.0E-08
sp|Q64633|UD17_RAT UDP-glucuronosyltransferase 1-7 OS=Rattus norvegicus GN=Ugt1a7c PE=2 SV=1 308 478 1.0E-07
sp|Q64637|UD13_RAT UDP-glucuronosyltransferase 1-3 OS=Rattus norvegicus GN=Ugt1a3 PE=2 SV=1 308 478 1.0E-07
sp|O23406|U75D1_ARATH UDP-glycosyltransferase 75D1 OS=Arabidopsis thaliana GN=UGT75D1 PE=2 SV=2 254 430 1.0E-07
sp|Q9HAW7|UD17_HUMAN UDP-glucuronosyltransferase 1-7 OS=Homo sapiens GN=UGT1A7 PE=1 SV=2 265 478 2.0E-07
sp|P22309|UD11_HUMAN UDP-glucuronosyltransferase 1-1 OS=Homo sapiens GN=UGT1A1 PE=1 SV=1 266 478 3.0E-07
sp|P35503|UD13_HUMAN UDP-glucuronosyltransferase 1-3 OS=Homo sapiens GN=UGT1A3 PE=1 SV=1 308 478 7.0E-07
sp|P96560|GTFC_AMYOR Glycosyltransferase GtfC OS=Amycolatopsis orientalis GN=gtfC PE=1 SV=1 393 501 2.0E-06
sp|P96559|GTFB_AMYOR Vancomycin aglycone glucosyltransferase OS=Amycolatopsis orientalis GN=gtfB PE=1 SV=1 389 490 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008194 UDP-glycosyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016757 glycosyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8614
MEPPSILLLTNEEHGQSNVFMATCESLLQLEPDAHLHLASFAGLADSVAAFNDRVRLSMPAARPVRFHHIRGVPS
SQGLRQVVVDRAIVCHGDVLPKSFFAPLSFTNSIRAIRDTMSIFVPYTAPQMAEIVSSVVELVNMVGADLVVVDS
LMTPALTACHHLGISFVCLSPNSIKDFAVKEQPLRVRLKHPALFSGHRYPVPLYLAPLNILYKIIAAVLYYRDGH
RRKVAAHIATHTGATLTTAVETYLGAGAKPMTLVGSMPELDYPGLVPPYIIPCGPIIRGAPPVRDADPDLAAWLA
RAPTLYVNLGSLYSIHEPQALELARALKTVMGAVPRLQVLWKLKRMGRYGVSEPGDAIHDTLTEELKADRVRVVI
DWLMAEPSSILESGHVICSMHHGGANSFYEAVVTGVPQVVLPQWTDTYDYAERVELLGIGRLGNETTKPRWTAVE
VAAALTDVLNSSTIKAKASTLAKLCQDRGSGAANAARAILAECRVRKQSKVGEDEKRAADMVTA
Coding >Ophio5|8614
ATGGAGCCTCCCAGCATCCTGCTGCTGACCAACGAGGAGCACGGCCAGTCCAACGTATTCATGGCCACGTGCGAG
TCCCTACTGCAACTCGAGCCCGATGCCCATCTTCACCTCGCCTCCTTCGCCGGGCTCGCCGACTCCGTCGCCGCC
TTCAACGACCGGGTGCGCCTTTCGATGCCGGCCGCCCGGCCCGTCCGCTTTCACCACATCCGGGGCGTGCCCTCG
TCTCAGGGGCTGCGCCAGGTCGTCGTCGACCGGGCCATCGTTTGCCACGGAGATGTGCTGCCCAAGTCCTTCTTC
GCGCCGCTGAGCTTCACCAACTCCATACGGGCCATCCGTGACACCATGTCCATCTTCGTGCCTTATACCGCACCG
CAGATGGCCGAAATTGTCTCTTCCGTTGTCGAGCTCGTGAACATGGTCGGCGCCGACCTCGTCGTCGTCGACAGT
CTCATGACACCCGCGCTGACGGCCTGCCACCACCTGGGCATCAGTTTCGTCTGCCTGAGCCCCAACAGTATCAAA
GACTTCGCCGTCAAGGAGCAACCGCTGCGAGTGCGGCTGAAACATCCCGCCCTCTTCTCAGGCCATCGTTACCCG
GTGCCCTTGTACTTGGCGCCGCTCAACATCTTGTACAAGATCATCGCCGCCGTCCTCTACTACCGAGACGGCCAT
CGACGAAAGGTGGCCGCGCACATCGCCACCCACACGGGCGCCACGCTGACCACCGCCGTCGAAACCTATCTCGGC
GCCGGCGCCAAGCCCATGACCTTGGTCGGCTCGATGCCGGAGCTCGACTATCCCGGCTTGGTGCCGCCCTACATC
ATCCCTTGCGGACCCATCATCCGCGGTGCGCCGCCCGTCCGAGATGCCGACCCGGACCTGGCGGCATGGCTGGCG
CGGGCGCCGACGCTGTACGTCAACCTAGGCTCGCTGTATAGCATCCACGAGCCTCAGGCACTGGAGCTGGCGCGG
GCCCTCAAGACGGTCATGGGCGCCGTGCCTCGTCTGCAGGTGCTCTGGAAGCTGAAGCGGATGGGCCGCTATGGC
GTATCGGAGCCCGGCGACGCCATCCACGACACCCTGACCGAGGAACTGAAAGCCGACCGAGTGCGCGTCGTCATC
GACTGGCTGATGGCTGAGCCCAGCTCCATCCTCGAGTCGGGTCACGTCATCTGCTCCATGCACCACGGGGGCGCA
AACTCATTTTACGAGGCCGTCGTCACCGGCGTGCCACAGGTGGTGCTACCGCAGTGGACGGACACGTACGACTAT
GCCGAGCGCGTCGAGCTCCTGGGCATCGGCCGACTGGGCAACGAGACGACGAAGCCGCGGTGGACGGCGGTCGAG
GTGGCAGCCGCTCTGACGGACGTCTTGAATTCGAGCACCATCAAGGCCAAGGCGAGCACGCTGGCCAAGCTCTGC
CAAGACCGGGGCAGCGGCGCGGCAAACGCTGCGCGGGCGATCCTAGCCGAGTGCCGGGTCAGAAAACAGTCAAAG
GTCGGAGAGGATGAGAAGCGAGCGGCGGACATGGTGACGGCT
Transcript >Ophio5|8614
ATGGAGCCTCCCAGCATCCTGCTGCTGACCAACGAGGAGCACGGCCAGTCCAACGTATTCATGGCCACGTGCGAG
TCCCTACTGCAACTCGAGCCCGATGCCCATCTTCACCTCGCCTCCTTCGCCGGGCTCGCCGACTCCGTCGCCGCC
TTCAACGACCGGGTGCGCCTTTCGATGCCGGCCGCCCGGCCCGTCCGCTTTCACCACATCCGGGGCGTGCCCTCG
TCTCAGGGGCTGCGCCAGGTCGTCGTCGACCGGGCCATCGTTTGCCACGGAGATGTGCTGCCCAAGTCCTTCTTC
GCGCCGCTGAGCTTCACCAACTCCATACGGGCCATCCGTGACACCATGTCCATCTTCGTGCCTTATACCGCACCG
CAGATGGCCGAAATTGTCTCTTCCGTTGTCGAGCTCGTGAACATGGTCGGCGCCGACCTCGTCGTCGTCGACAGT
CTCATGACACCCGCGCTGACGGCCTGCCACCACCTGGGCATCAGTTTCGTCTGCCTGAGCCCCAACAGTATCAAA
GACTTCGCCGTCAAGGAGCAACCGCTGCGAGTGCGGCTGAAACATCCCGCCCTCTTCTCAGGCCATCGTTACCCG
GTGCCCTTGTACTTGGCGCCGCTCAACATCTTGTACAAGATCATCGCCGCCGTCCTCTACTACCGAGACGGCCAT
CGACGAAAGGTGGCCGCGCACATCGCCACCCACACGGGCGCCACGCTGACCACCGCCGTCGAAACCTATCTCGGC
GCCGGCGCCAAGCCCATGACCTTGGTCGGCTCGATGCCGGAGCTCGACTATCCCGGCTTGGTGCCGCCCTACATC
ATCCCTTGCGGACCCATCATCCGCGGTGCGCCGCCCGTCCGAGATGCCGACCCGGACCTGGCGGCATGGCTGGCG
CGGGCGCCGACGCTGTACGTCAACCTAGGCTCGCTGTATAGCATCCACGAGCCTCAGGCACTGGAGCTGGCGCGG
GCCCTCAAGACGGTCATGGGCGCCGTGCCTCGTCTGCAGGTGCTCTGGAAGCTGAAGCGGATGGGCCGCTATGGC
GTATCGGAGCCCGGCGACGCCATCCACGACACCCTGACCGAGGAACTGAAAGCCGACCGAGTGCGCGTCGTCATC
GACTGGCTGATGGCTGAGCCCAGCTCCATCCTCGAGTCGGGTCACGTCATCTGCTCCATGCACCACGGGGGCGCA
AACTCATTTTACGAGGCCGTCGTCACCGGCGTGCCACAGGTGGTGCTACCGCAGTGGACGGACACGTACGACTAT
GCCGAGCGCGTCGAGCTCCTGGGCATCGGCCGACTGGGCAACGAGACGACGAAGCCGCGGTGGACGGCGGTCGAG
GTGGCAGCCGCTCTGACGGACGTCTTGAATTCGAGCACCATCAAGGCCAAGGCGAGCACGCTGGCCAAGCTCTGC
CAAGACCGGGGCAGCGGCGCGGCAAACGCTGCGCGGGCGATCCTAGCCGAGTGCCGGGTCAGAAAACAGTCAAAG
GTCGGAGAGGATGAGAAGCGAGCGGCGGACATGGTGACGGCTTGA
Gene >Ophio5|8614
ATGGAGCCTCCCAGCATCCTGCTGCTGACCAACGAGGAGCACGGCCAGTCCAACGTATTCATGGCCACGTGCGAG
TCCCTACTGCAACTCGAGCCCGATGCCCATCTTCACCTCGCCTCCTTCGCCGGGCTCGCCGACTCCGTCGCCGCC
TTCAACGACCGGGTGCGCCTTTCGATGCCGGCCGCCCGGCCCGTCCGCTTTCACCACATCCGGGGCGTGCCCTCG
TCTCAGGGGCTGCGCCAGGTCGTCGTCGACCGGGCCATCGTTTGCCACGGAGATGTGCTGCCCAAGTCCTTCTTC
GCGCCGCTGAGCTTCACCAACTCCATACGGGCCATCCGTGACACCATGTCCATCTTCGTGCCTTATACCGCACCG
CAGATGGCCGAAATTGTCTCTTCCGTTGTCGAGCTCGTGAACATGGTCGGCGCCGACCTCGTCGTCGTCGACAGT
CTCATGACACCCGCGCTGACGGCCTGCCACCACCTGGGCATCAGTTTCGTCTGCCTGAGCCCCAACAGTATCAAA
GACTTCGCCGTCAAGGAGCAACCGCTGCGAGTGCGGCTGAAACATCCCGCGTACGTCCCGTTGGAGATGCTCGCT
GGCCGTCGAGCGCGCTGACCTTGGCTTGTGCCCCAGCCTCTTCTCAGGCCATCGTTACCCGGTGCCCTTGTACTT
GGCGCCGCTCAACATCTTGTACAAGATCATCGCCGCCGTCCTCTACTACCGAGACGGCCATCGACGAAAGGTGGC
CGCGCACATCGCCACCCACACGGGCGCCACGCTGACCACCGCCGTCGAAACCTATCTCGGCGCCGGCGCCAAGCC
CATGACCTTGGTCGGCTCGATGCCGGAGCTCGACTATCCCGGCTTGGTGCCGCCCTACATCATCCCTTGCGGACC
CATCATCCGCGGTGCGCCGCCCGTCCGAGATGCCGACCCGGACCTGGCGGCATGGCTGGCGCGGGCGCCGACGCT
GTACGTCAACCTAGGCTCGCTGTATAGCATCCACGAGCCTCAGGCACTGGAGCTGGCGCGGGCCCTCAAGACGGT
CATGGGCGCCGTGCCTCGTCTGCAGGTGCTCTGGAAGCTGAAGCGGATGGGCCGCTATGGCGTATCGGAGCCCGG
CGACGCCATCCACGACACCCTGACCGAGGAACTGAAAGCCGACCGAGTGCGCGTCGTCATCGACTGGCTGATGGC
TGAGCCCAGCTCCATCCTCGAGTCGGGTCACGTCATCTGCTCCATGCACCACGGGGGCGCAAACTCATTTTACGA
GGCCGTCGTGTAAGTCACTTGACCCAACAACACCGGACAAGTCTCTGACCAACGGCGAGCAGCACCGGCGTGCCA
CAGGTGGTGCTACCGCAGTGGACGGACACGTACGACTATGCCGAGCGCGTCGAGCTCCTGGGCATCGGCCGACTG
GGCAACGAGACGACGAAGCCGCGGTGGACGGCGGTCGAGGTGGCAGCCGCTCTGACGGACGTCTTGAATTCGAGC
ACCATCAAGGCCAAGGCGAGCACGCTGGCCAAGCTCTGCCAAGACCGGGGCAGCGGCGCGGCAAACGCTGCGCGG
GCGATCCTAGCCGAGTGCCGGGTCAGAAAACAGTCAAAGGTCGGAGAGGATGAGAAGCGAGCGGCGGACATGGTG
ACGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail