Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8609
Gene name
Locationscaffold_99:41778..43071
Strand+
Gene length (bp)1293
Transcript length (bp)1293
Coding sequence length (bp)1290
Protein length (aa) 430

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11790 Glyco_hydro_cc Glycosyl hydrolase catalytic core 2.1E-56 193 426

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09788|ASL1_SCHPO Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=asl1 PE=1 SV=1 190 426 1.0E-15

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 785.95 294.08 1277.82
CcL In ants, during behavior modification 1790.83 399.50 3182.15
CcD In ants, recently dead 738.97 280.98 1196.96

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.022654 yes
SC16a CcD 0.870403 no
CcL CcD 0.013694 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8609
MSAKKIVILAAVAALAEQASAFNSHRHLHRREPKYGAVHWVTVWTTATTTIYDAEKTAVSGPEHVANYAPVQAEA
VKPTSNAVYLKSEAPAQPPAPAAQSPAPAAQSPAPYAPPPPPEVESEAPAVPSPRSPSAAPEAPKTTLEIQPKPI
NSLLQPIAPYVPPLAPSVAPSNPSGGGNGNSASGSPGFSGKRGLAYNDASLANNFDDQCNGCSGWGYNWGSTPQG
LSSKISYVPMLWGNKPEFTKNWHSDAQKAVDNGAKAMFSFNEPDNAGQANMSPQQAAELHVQYMNPWGGKALIGS
PAITNSGQAGQGIEWLGSFVKACDNMQEKCRIDFCVVHWYSQPEYADTLYDHIAKAHKVCGQKPIWLTEFGPVDA
GGQPMDAPAFLKTVVRKLDEIEYLHAYAPFMCSAGKLMSSANQLSAMGKAYADVS
Coding >Ophio5|8609
ATGTCGGCCAAAAAGATCGTCATCCTCGCCGCCGTTGCCGCTCTGGCTGAGCAGGCTTCGGCTTTCAACTCACAC
CGCCATCTTCATCGTCGCGAGCCCAAGTACGGCGCTGTCCACTGGGTCACCGTCTGGACCACCGCCACCACCACC
ATCTATGATGCCGAGAAGACTGCAGTGTCTGGACCTGAGCATGTCGCCAACTACGCTCCGGTCCAAGCCGAAGCC
GTCAAGCCAACCTCCAACGCCGTCTATCTCAAGTCTGAGGCTCCCGCTCAGCCTCCTGCACCCGCTGCTCAGTCG
CCCGCTCCCGCTGCCCAGTCTCCGGCCCCCTATGCCCCGCCCCCTCCTCCCGAGGTTGAGTCTGAGGCTCCCGCT
GTTCCGTCGCCCCGGTCGCCTTCCGCCGCGCCCGAGGCCCCAAAGACGACGCTCGAGATTCAGCCCAAGCCCATT
AATTCACTCCTGCAGCCCATCGCCCCGTACGTGCCACCCCTGGCGCCGTCGGTTGCCCCCTCAAACCCCTCTGGC
GGTGGCAACGGCAATTCTGCATCGGGCTCTCCTGGCTTCTCGGGCAAGCGAGGCTTGGCTTACAACGACGCGAGC
CTCGCCAACAATTTCGACGACCAGTGCAACGGATGCAGCGGCTGGGGCTACAACTGGGGATCCACGCCCCAGGGT
CTCTCGTCCAAGATCAGCTACGTCCCCATGCTTTGGGGCAACAAGCCCGAGTTCACCAAGAACTGGCACTCGGAC
GCGCAAAAGGCCGTCGACAACGGCGCCAAGGCCATGTTCAGCTTCAACGAGCCCGACAACGCCGGCCAGGCCAAC
ATGAGCCCTCAGCAGGCGGCCGAGCTCCACGTGCAATACATGAACCCTTGGGGCGGCAAGGCCCTCATCGGCTCA
CCGGCCATCACCAACAGCGGCCAAGCCGGCCAGGGCATCGAGTGGCTCGGCAGCTTCGTGAAGGCGTGCGACAAC
ATGCAGGAAAAGTGCCGCATCGACTTTTGCGTCGTTCACTGGTACTCGCAGCCCGAATACGCCGACACGCTGTAC
GACCACATCGCCAAGGCCCACAAGGTGTGCGGCCAGAAGCCCATCTGGCTGACCGAGTTCGGCCCCGTCGACGCT
GGCGGCCAGCCGATGGACGCCCCGGCCTTCCTCAAGACGGTCGTTCGCAAGCTCGACGAGATTGAGTACCTTCAC
GCCTACGCGCCCTTCATGTGCTCCGCGGGCAAGCTCATGTCTTCGGCCAACCAGTTGAGCGCCATGGGCAAGGCC
TACGCCGATGTGTCT
Transcript >Ophio5|8609
ATGTCGGCCAAAAAGATCGTCATCCTCGCCGCCGTTGCCGCTCTGGCTGAGCAGGCTTCGGCTTTCAACTCACAC
CGCCATCTTCATCGTCGCGAGCCCAAGTACGGCGCTGTCCACTGGGTCACCGTCTGGACCACCGCCACCACCACC
ATCTATGATGCCGAGAAGACTGCAGTGTCTGGACCTGAGCATGTCGCCAACTACGCTCCGGTCCAAGCCGAAGCC
GTCAAGCCAACCTCCAACGCCGTCTATCTCAAGTCTGAGGCTCCCGCTCAGCCTCCTGCACCCGCTGCTCAGTCG
CCCGCTCCCGCTGCCCAGTCTCCGGCCCCCTATGCCCCGCCCCCTCCTCCCGAGGTTGAGTCTGAGGCTCCCGCT
GTTCCGTCGCCCCGGTCGCCTTCCGCCGCGCCCGAGGCCCCAAAGACGACGCTCGAGATTCAGCCCAAGCCCATT
AATTCACTCCTGCAGCCCATCGCCCCGTACGTGCCACCCCTGGCGCCGTCGGTTGCCCCCTCAAACCCCTCTGGC
GGTGGCAACGGCAATTCTGCATCGGGCTCTCCTGGCTTCTCGGGCAAGCGAGGCTTGGCTTACAACGACGCGAGC
CTCGCCAACAATTTCGACGACCAGTGCAACGGATGCAGCGGCTGGGGCTACAACTGGGGATCCACGCCCCAGGGT
CTCTCGTCCAAGATCAGCTACGTCCCCATGCTTTGGGGCAACAAGCCCGAGTTCACCAAGAACTGGCACTCGGAC
GCGCAAAAGGCCGTCGACAACGGCGCCAAGGCCATGTTCAGCTTCAACGAGCCCGACAACGCCGGCCAGGCCAAC
ATGAGCCCTCAGCAGGCGGCCGAGCTCCACGTGCAATACATGAACCCTTGGGGCGGCAAGGCCCTCATCGGCTCA
CCGGCCATCACCAACAGCGGCCAAGCCGGCCAGGGCATCGAGTGGCTCGGCAGCTTCGTGAAGGCGTGCGACAAC
ATGCAGGAAAAGTGCCGCATCGACTTTTGCGTCGTTCACTGGTACTCGCAGCCCGAATACGCCGACACGCTGTAC
GACCACATCGCCAAGGCCCACAAGGTGTGCGGCCAGAAGCCCATCTGGCTGACCGAGTTCGGCCCCGTCGACGCT
GGCGGCCAGCCGATGGACGCCCCGGCCTTCCTCAAGACGGTCGTTCGCAAGCTCGACGAGATTGAGTACCTTCAC
GCCTACGCGCCCTTCATGTGCTCCGCGGGCAAGCTCATGTCTTCGGCCAACCAGTTGAGCGCCATGGGCAAGGCC
TACGCCGATGTGTCTTAG
Gene >Ophio5|8609
ATGTCGGCCAAAAAGATCGTCATCCTCGCCGCCGTTGCCGCTCTGGCTGAGCAGGCTTCGGCTTTCAACTCACAC
CGCCATCTTCATCGTCGCGAGCCCAAGTACGGCGCTGTCCACTGGGTCACCGTCTGGACCACCGCCACCACCACC
ATCTATGATGCCGAGAAGACTGCAGTGTCTGGACCTGAGCATGTCGCCAACTACGCTCCGGTCCAAGCCGAAGCC
GTCAAGCCAACCTCCAACGCCGTCTATCTCAAGTCTGAGGCTCCCGCTCAGCCTCCTGCACCCGCTGCTCAGTCG
CCCGCTCCCGCTGCCCAGTCTCCGGCCCCCTATGCCCCGCCCCCTCCTCCCGAGGTTGAGTCTGAGGCTCCCGCT
GTTCCGTCGCCCCGGTCGCCTTCCGCCGCGCCCGAGGCCCCAAAGACGACGCTCGAGATTCAGCCCAAGCCCATT
AATTCACTCCTGCAGCCCATCGCCCCGTACGTGCCACCCCTGGCGCCGTCGGTTGCCCCCTCAAACCCCTCTGGC
GGTGGCAACGGCAATTCTGCATCGGGCTCTCCTGGCTTCTCGGGCAAGCGAGGCTTGGCTTACAACGACGCGAGC
CTCGCCAACAATTTCGACGACCAGTGCAACGGATGCAGCGGCTGGGGCTACAACTGGGGATCCACGCCCCAGGGT
CTCTCGTCCAAGATCAGCTACGTCCCCATGCTTTGGGGCAACAAGCCCGAGTTCACCAAGAACTGGCACTCGGAC
GCGCAAAAGGCCGTCGACAACGGCGCCAAGGCCATGTTCAGCTTCAACGAGCCCGACAACGCCGGCCAGGCCAAC
ATGAGCCCTCAGCAGGCGGCCGAGCTCCACGTGCAATACATGAACCCTTGGGGCGGCAAGGCCCTCATCGGCTCA
CCGGCCATCACCAACAGCGGCCAAGCCGGCCAGGGCATCGAGTGGCTCGGCAGCTTCGTGAAGGCGTGCGACAAC
ATGCAGGAAAAGTGCCGCATCGACTTTTGCGTCGTTCACTGGTACTCGCAGCCCGAATACGCCGACACGCTGTAC
GACCACATCGCCAAGGCCCACAAGGTGTGCGGCCAGAAGCCCATCTGGCTGACCGAGTTCGGCCCCGTCGACGCT
GGCGGCCAGCCGATGGACGCCCCGGCCTTCCTCAAGACGGTCGTTCGCAAGCTCGACGAGATTGAGTACCTTCAC
GCCTACGCGCCCTTCATGTGCTCCGCGGGCAAGCTCATGTCTTCGGCCAACCAGTTGAGCGCCATGGGCAAGGCC
TACGCCGATGTGTCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail