Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8606
Gene name
Locationscaffold_99:27165..28851
Strand+
Gene length (bp)1686
Transcript length (bp)1368
Coding sequence length (bp)1365
Protein length (aa) 455

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 113 135 22
2 148 165 17
3 196 213 17
4 225 247 22
5 272 294 22
6 306 328 22
7 348 370 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 4.56 1.24 7.88
CcL In ants, during behavior modification 80.07 23.36 136.78
CcD In ants, recently dead 18.01 7.76 28.26

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8606
MPSICDLQFLTRTCLPSGCRTEVQKRAALPPPLPREYASSANRIYVHVLAEMLRIGRVGLVRHSPDSLPGEPHDS
SRVPIMMAAPIDPNTTPALMPPAGVVPDPLNSHTGQPLLVGMATAGVSLTTVCTVIRLYTKHVILKQLNVEDFLL
VFATLGLAAFSAILLSNGDAGQGHHQWNMSIANVRRVALFANVSETLYAPVMFAAKAAVLLSLKRIFTGAQRNYV
HWAFVLLIVLNGLFYLSIMFAFVFACVPRGKIENSSLPGTCISTNGLLLATSASNILSDVSILLLPLIVVCSLQT
PLKRKVTVGAVFMTGFFGCISSVLRLYYSILLFLTDDMTWAIYPVGVWAVAEIATVILACCFPVFPRFLYHVRHG
GKARRSSNPFVKGYRVNSSAEAYPLQYNRGVYTETTLTAAPWDSSSVQRVMGKDDSVELNERNMSDEGRSVTPVA
GGRRT
Coding >Ophio5|8606
ATGCCGTCTATCTGCGACTTGCAGTTCTTGACTCGGACCTGTTTACCGTCCGGTTGCCGAACCGAGGTCCAGAAA
AGGGCAGCATTGCCCCCACCGCTACCCCGCGAGTATGCTTCATCCGCAAACCGGATTTACGTACACGTACTCGCG
GAGATGCTACGGATAGGGCGCGTCGGCCTTGTACGCCACTCTCCAGACTCTCTCCCCGGAGAGCCTCATGACAGC
TCCCGAGTCCCAATCATGATGGCGGCTCCCATTGATCCCAACACGACGCCCGCGTTGATGCCGCCCGCCGGCGTG
GTGCCCGACCCCCTCAACTCGCATACCGGGCAGCCCTTGCTGGTGGGAATGGCGACGGCAGGCGTGTCTTTGACG
ACGGTTTGCACCGTCATTCGTCTTTACACGAAGCATGTGATCTTGAAGCAGCTGAACGTAGAGGACTTTTTGCTG
GTTTTCGCGACGCTGGGACTCGCCGCCTTCAGTGCCATCTTATTGTCAAACGGCGACGCCGGCCAGGGACATCAT
CAATGGAACATGTCTATCGCCAACGTCCGGAGAGTGGCTTTGTTTGCCAACGTCAGCGAGACCCTTTACGCACCG
GTCATGTTCGCCGCCAAGGCGGCTGTGCTGCTAAGCTTGAAGCGTATCTTCACCGGGGCACAGAGAAACTATGTG
CATTGGGCATTCGTTCTGTTGATTGTGCTCAATGGTCTGTTCTACCTCTCCATCATGTTCGCCTTCGTCTTCGCC
TGCGTGCCGCGAGGCAAGATTGAGAATTCTTCGCTGCCTGGGACCTGCATCTCCACCAACGGGCTGCTCTTGGCA
ACGTCTGCATCCAACATTCTGTCGGACGTGTCTATTCTCCTGCTTCCCCTCATTGTGGTCTGTTCGTTGCAAACG
CCGTTGAAGAGAAAGGTGACGGTGGGGGCGGTTTTCATGACGGGTTTCTTCGGGTGCATTTCCAGTGTCTTGCGA
CTCTACTACAGCATCCTGCTGTTCCTCACCGACGATATGACCTGGGCAATCTACCCTGTTGGGGTGTGGGCTGTG
GCCGAGATTGCCACCGTTATCCTTGCCTGTTGCTTTCCCGTGTTCCCGCGATTTTTATACCATGTCCGGCATGGC
GGCAAGGCGCGGAGGTCGAGCAACCCGTTTGTCAAAGGCTATCGAGTAAATTCGTCCGCGGAAGCATACCCACTA
CAGTATAATCGTGGCGTCTACACCGAGACGACCTTGACGGCCGCGCCATGGGATTCTAGTTCGGTTCAACGTGTG
ATGGGCAAGGACGATTCCGTGGAGTTGAACGAGAGGAATATGAGCGATGAAGGTCGTTCGGTGACGCCGGTTGCT
GGCGGGCGCCGGACC
Transcript >Ophio5|8606
ATGCCGTCTATCTGCGACTTGCAGTTCTTGACTCGGACCTGTTTACCGTCCGGTTGCCGAACCGAGGTCCAGAAA
AGGGCAGCATTGCCCCCACCGCTACCCCGCGAGTATGCTTCATCCGCAAACCGGATTTACGTACACGTACTCGCG
GAGATGCTACGGATAGGGCGCGTCGGCCTTGTACGCCACTCTCCAGACTCTCTCCCCGGAGAGCCTCATGACAGC
TCCCGAGTCCCAATCATGATGGCGGCTCCCATTGATCCCAACACGACGCCCGCGTTGATGCCGCCCGCCGGCGTG
GTGCCCGACCCCCTCAACTCGCATACCGGGCAGCCCTTGCTGGTGGGAATGGCGACGGCAGGCGTGTCTTTGACG
ACGGTTTGCACCGTCATTCGTCTTTACACGAAGCATGTGATCTTGAAGCAGCTGAACGTAGAGGACTTTTTGCTG
GTTTTCGCGACGCTGGGACTCGCCGCCTTCAGTGCCATCTTATTGTCAAACGGCGACGCCGGCCAGGGACATCAT
CAATGGAACATGTCTATCGCCAACGTCCGGAGAGTGGCTTTGTTTGCCAACGTCAGCGAGACCCTTTACGCACCG
GTCATGTTCGCCGCCAAGGCGGCTGTGCTGCTAAGCTTGAAGCGTATCTTCACCGGGGCACAGAGAAACTATGTG
CATTGGGCATTCGTTCTGTTGATTGTGCTCAATGGTCTGTTCTACCTCTCCATCATGTTCGCCTTCGTCTTCGCC
TGCGTGCCGCGAGGCAAGATTGAGAATTCTTCGCTGCCTGGGACCTGCATCTCCACCAACGGGCTGCTCTTGGCA
ACGTCTGCATCCAACATTCTGTCGGACGTGTCTATTCTCCTGCTTCCCCTCATTGTGGTCTGTTCGTTGCAAACG
CCGTTGAAGAGAAAGGTGACGGTGGGGGCGGTTTTCATGACGGGTTTCTTCGGGTGCATTTCCAGTGTCTTGCGA
CTCTACTACAGCATCCTGCTGTTCCTCACCGACGATATGACCTGGGCAATCTACCCTGTTGGGGTGTGGGCTGTG
GCCGAGATTGCCACCGTTATCCTTGCCTGTTGCTTTCCCGTGTTCCCGCGATTTTTATACCATGTCCGGCATGGC
GGCAAGGCGCGGAGGTCGAGCAACCCGTTTGTCAAAGGCTATCGAGTAAATTCGTCCGCGGAAGCATACCCACTA
CAGTATAATCGTGGCGTCTACACCGAGACGACCTTGACGGCCGCGCCATGGGATTCTAGTTCGGTTCAACGTGTG
ATGGGCAAGGACGATTCCGTGGAGTTGAACGAGAGGAATATGAGCGATGAAGGTCGTTCGGTGACGCCGGTTGCT
GGCGGGCGCCGGACCTGA
Gene >Ophio5|8606
ATGCCGTCTATCTGCGACTTGCAGTTCTTGACTCGGACCTGTTTACCGTCCGGTTGCCGAACCGAGGTCCAGAAA
AGGGCAGCATTGCCCCCACCGCTACCCCGCGAGTATGCTTCATCCGCAAACCGGATTTACGTACACGTACTCGCG
GAGATGCTACGGATAGGGGTAAGAGAAAACATGCCCAATGACTTAAACCGAACGGATACAGCGCGTCGGCCTTGT
ACGCCACTCTCCAGACTCTCTCCCCGGAGAGCCTCATGACAGCTCCCGAGTCCCAATCATGATGGCGGCTCCCAT
TGATCCCAACACGACGCCCGCGTTGATGCCGCCCGCCGGCGTGGTGCCCGACCCCCTCAACTCGCATACCGGGCA
GCCCTTGCTGGTGGGAATGGCGACGGCAGGCGTGTCTTTGACGACGGTTTGCACCGTCATTCGTCTTTACACGAA
GCATGTGATCTTGAAGCAGCTGAACGTAGAGGACTGTAAGTGCAGATGGGACTAGACGATACGGAGGCTCTCTCT
AATCTTCGATTAGTTTTGCTGGTTTTCGCGACGGTACGTTTGTCTTGAGCAGTCTGCGTCGCCGGTGAAGCTGAG
ATGATGTGGCCACGGTTCCAGCTGGGACTCGCCGCCTTCAGTGCCATCTTATTGTCAAACGGCGACGCCGGCCAG
GGACATCATCAATGGAACATGTCTATCGCCAACGTCCGGAGAGTGGCTTTGGTACGAAACAGACTCAGTTCTCGG
CCAGACGAGGACAGACTGACTGAGGCAGAATATATAGTTTGCCAACGTCAGCGAGACCCTTTACGCACCGGTCAT
GTTCGCCGCCAAGGCGGCTGTGCTGCTAAGCTTGAAGCGTATCTTCACCGGGGCACAGAGAAACTATGTGCATTG
GGCATTCGTTCTGTTGATTGTGCTCAATGGTCTGTTCTACCTCTCCATCATGTTCGCCTTCGTCTTCGCCTGCGT
GCCGCGAGGCAAGATTGAGAATTCTTCGCTGCCTGGGACCTGCATCTCCACCAACGGGCTGCTCTTGGCAACGTC
TGCATCCAACATTCTGTCGGACGTGTCTATTCTCCTGCTTCCCCTCATTGTGGTCTGTTCGTTGCAAACGCCGTT
GAAGAGAAAGGTGACGGTGGGGGCGGTTTTCATGACGGGTTTCTTGTAAGAATGACTCCCGTCTTCGTCGAAACG
AACGGCTGACTTGTGGCCAGCGGGTGCATTTCCAGTGTCTTGCGACTCTACTACAGCATCCTGCTGTTCCTCACC
GACGATATGACCTGGGCAATCTACCCTGTTGGGGTGTGGGCGTACGTTTGATACCCTCGCCAGCCTCTCCCATAC
TGACAGATTTCCAGTGTGGCCGAGATTGCCACCGTTATCCTTGCCTGTTGCTTTCCCGTGTTCCCGCGATTTTTA
TACCATGTCCGGCATGGCGGCAAGGCGCGGAGGTCGAGCAACCCGTTTGTCAAAGGCTATCGAGTAAATTCGTCC
GCGGAAGCATACCCACTACAGTATAATCGTGGCGTCTACACCGAGACGACCTTGACGGCCGCGCCATGGGATTCT
AGTTCGGTTCAACGTGTGATGGGCAAGGACGATTCCGTGGAGTTGAACGAGAGGAATATGAGCGATGAAGGTCGT
TCGGTGACGCCGGTTGCTGGCGGGCGCCGGACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail