Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8598
Gene name
Locationscaffold_99:6688..9553
Strand-
Gene length (bp)2865
Transcript length (bp)2604
Coding sequence length (bp)2601
Protein length (aa) 867

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01496 V_ATPase_I V-type ATPase 116kDa subunit family 0.0E+00 32 852

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32563|VPH1_YEAST V-type proton ATPase subunit a, vacuolar isoform OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPH1 PE=1 SV=3 1 852 0.0E+00
sp|Q8W4S4|VHAA3_ARATH V-type proton ATPase subunit a3 OS=Arabidopsis thaliana GN=VHA-a3 PE=1 SV=1 10 860 0.0E+00
sp|Q9SJT7|VHAA2_ARATH V-type proton ATPase subunit a2 OS=Arabidopsis thaliana GN=VHA-a2 PE=1 SV=1 10 860 0.0E+00
sp|Q54E04|VATM_DICDI Vacuolar proton translocating ATPase 100 kDa subunit OS=Dictyostelium discoideum GN=vatM PE=1 SV=2 10 861 0.0E+00
sp|P15920|VPP2_MOUSE V-type proton ATPase 116 kDa subunit a isoform 2 OS=Mus musculus GN=Atp6v0a2 PE=1 SV=2 9 849 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32563|VPH1_YEAST V-type proton ATPase subunit a, vacuolar isoform OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPH1 PE=1 SV=3 1 852 0.0E+00
sp|Q8W4S4|VHAA3_ARATH V-type proton ATPase subunit a3 OS=Arabidopsis thaliana GN=VHA-a3 PE=1 SV=1 10 860 0.0E+00
sp|Q9SJT7|VHAA2_ARATH V-type proton ATPase subunit a2 OS=Arabidopsis thaliana GN=VHA-a2 PE=1 SV=1 10 860 0.0E+00
sp|Q54E04|VATM_DICDI Vacuolar proton translocating ATPase 100 kDa subunit OS=Dictyostelium discoideum GN=vatM PE=1 SV=2 10 861 0.0E+00
sp|P15920|VPP2_MOUSE V-type proton ATPase 116 kDa subunit a isoform 2 OS=Mus musculus GN=Atp6v0a2 PE=1 SV=2 9 849 0.0E+00
sp|Q9Y487|VPP2_HUMAN V-type proton ATPase 116 kDa subunit a isoform 2 OS=Homo sapiens GN=ATP6V0A2 PE=1 SV=2 9 855 0.0E+00
sp|O97681|VPP2_BOVIN V-type proton ATPase 116 kDa subunit a isoform 2 OS=Bos taurus GN=ATP6V0A2 PE=2 SV=1 9 855 0.0E+00
sp|Q9HBG4|VPP4_HUMAN V-type proton ATPase 116 kDa subunit a isoform 4 OS=Homo sapiens GN=ATP6V0A4 PE=1 SV=2 9 861 0.0E+00
sp|Q920R6|VPP4_MOUSE V-type proton ATPase 116 kDa subunit a isoform 4 OS=Mus musculus GN=Atp6v0a4 PE=1 SV=1 9 861 0.0E+00
sp|Q9I8D0|VPP1_CHICK V-type proton ATPase 116 kDa subunit a isoform 1 OS=Gallus gallus GN=ATP6V0A1 PE=1 SV=1 9 857 0.0E+00
sp|P30628|VPP1_CAEEL Probable V-type proton ATPase 116 kDa subunit a OS=Caenorhabditis elegans GN=unc-32 PE=2 SV=3 3 866 0.0E+00
sp|Q29466|VPP1_BOVIN V-type proton ATPase 116 kDa subunit a isoform 1 OS=Bos taurus GN=ATP6V0A1 PE=2 SV=1 9 857 0.0E+00
sp|Q93050|VPP1_HUMAN V-type proton ATPase 116 kDa subunit a isoform 1 OS=Homo sapiens GN=ATP6V0A1 PE=1 SV=3 9 857 0.0E+00
sp|Q5R422|VPP1_PONAB V-type proton ATPase 116 kDa subunit a isoform 1 OS=Pongo abelii GN=ATP6V0A1 PE=2 SV=1 9 857 0.0E+00
sp|A1A5G6|VPP1_XENTR V-type proton ATPase 116 kDa subunit a isoform 1 OS=Xenopus tropicalis GN=atp6v0a1 PE=2 SV=1 9 857 0.0E+00
sp|P25286|VPP1_RAT V-type proton ATPase 116 kDa subunit a isoform 1 OS=Rattus norvegicus GN=Atp6v0a1 PE=2 SV=1 9 857 0.0E+00
sp|Q9Z1G4|VPP1_MOUSE V-type proton ATPase 116 kDa subunit a isoform 1 OS=Mus musculus GN=Atp6v0a1 PE=1 SV=3 9 857 0.0E+00
sp|Q8AVM5|VPP1_XENLA V-type proton ATPase 116 kDa subunit a isoform 1 OS=Xenopus laevis GN=atp6v0a1 PE=2 SV=1 9 857 0.0E+00
sp|P37296|STV1_YEAST V-type proton ATPase subunit a, Golgi isoform OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STV1 PE=1 SV=2 4 857 0.0E+00
sp|O13742|VPH1_SCHPO V-type proton ATPase subunit a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vph1 PE=3 SV=2 9 857 0.0E+00
sp|Q01290|VPH1_NEUCR V-type proton ATPase subunit a OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vph-1 PE=3 SV=1 1 867 0.0E+00
sp|Q8RWZ7|VHAA1_ARATH V-type proton ATPase subunit a1 OS=Arabidopsis thaliana GN=VHA-a1 PE=2 SV=1 3 855 3.0E-177
sp|Q13488|VPP3_HUMAN V-type proton ATPase 116 kDa subunit a isoform 3 OS=Homo sapiens GN=TCIRG1 PE=1 SV=3 9 854 1.0E-156
sp|Q9HM61|VATI_THEAC V-type ATP synthase subunit I OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=atpI PE=3 SV=1 89 500 2.0E-09
sp|O59659|VATI_METMA V-type ATP synthase subunit I OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=atpI PE=3 SV=2 341 570 5.0E-08
sp|Q9UWW3|VATI_SULSO V-type ATP synthase subunit I OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=atpI PE=3 SV=1 280 487 2.0E-07
sp|Q9UXU2|VATI_PYRAB V-type ATP synthase subunit I OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=atpI PE=3 SV=1 123 496 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0033179 proton-transporting V-type ATPase, V0 domain Yes
GO:0046961 proton-transporting ATPase activity, rotational mechanism Yes
GO:1902600 proton transmembrane transport Yes
GO:0005215 transporter activity No
GO:0055085 transmembrane transport No
GO:0034220 ion transmembrane transport No
GO:0003674 molecular_function No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0051179 localization No
GO:0006810 transport No
GO:0019829 ATPase-coupled cation transmembrane transporter activity No
GO:0022853 active ion transmembrane transporter activity No
GO:0098662 inorganic cation transmembrane transport No
GO:0051234 establishment of localization No
GO:0032991 protein-containing complex No
GO:0140657 ATP-dependent activity No
GO:0022804 active transmembrane transporter activity No
GO:0098655 cation transmembrane transport No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0022857 transmembrane transporter activity No
GO:0015399 primary active transmembrane transporter activity No
GO:0015078 proton transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0006812 cation transport No
GO:0006811 ion transport No
GO:0098660 inorganic ion transmembrane transport No
GO:0008324 cation transmembrane transporter activity No
GO:0098796 membrane protein complex No
GO:0042625 ATPase-coupled ion transmembrane transporter activity No
GO:0044769 ATPase activity, coupled to transmembrane movement of ions, rotational mechanism No
GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain No
GO:0009987 cellular process No
GO:0009678 pyrophosphate hydrolysis-driven proton transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Signal peptide|Transmembrane domain 0.1242 0.1379 0.0663 0.3041 0.0822 0.002 0.2765 0.744 0.4536 0.0112

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 420 442 22
2 462 484 22
3 550 567 17
4 579 601 22
5 648 670 22
6 793 815 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 95.94 48.77 143.12
CcL In ants, during behavior modification 92.89 47.12 138.66
CcD In ants, recently dead 107.05 53.32 160.79

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.918574 no
SC16a CcD 0.695907 no
CcL CcD 0.602684 no

Orthologs

Orthofinder run ID4
Orthogroup815
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3526
Ophiocordyceps australis map64 (Brazil) OphauB2|6530
Ophiocordyceps camponoti-floridani Ophcf2|06618
Ophiocordyceps camponoti-rufipedis Ophun1|7424
Ophiocordyceps kimflemingae Ophio5|8598 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3757
Ophiocordyceps subramaniannii Hirsu2|7967

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8598
MAPKQDTPFRSADMSMVQLYVSNEIGREVVTALGELGLCQFRDLNEQVSAFQRTYTQEIRRLDNVDRQLRYFYAQ
MEKAGIGLKKLDLDKERLASPSTAEIDELAERSQTLEQRISALNDSYETLKKREGDLTEWRWVLREAGSFFDRAH
GNVEEIRASTDNDDAPLLSDVEQHNAAPEVERSFSGMNIGFVAGVIARERVAAFERILWRTLRGNLYMNQSEIPE
QLIDPSNNEAIQKNVFVIFAHGKEILAKIRKISESMGADVYSVDENSDLRRDQIHEVNNRLDDVQSVLRNTQATL
EAELSQISQSLSAWMVLVAKEKAVYSTLNLFSYDRARRTLIAEAWCPTNDLPLIRSTLQDVTNRAGLSIPSIINQ
IRTNKTPPTYIKTNKFTEGFQTIVNAYGTATYQEVNPAMPVIVTFPFLFAVMFGDFGHAIIMLSAALAMIYWEKA
LKKVTFELFAMVFYGRYIALVMAVFSIFTGLIYNDSFSKSMTLFDSAWAYKKPDGWKEGQTVDAQLNSDGYRYPF
GIDWAWHGTDNELLFSNSFKMKMSIILGWAHMTYSLCFAYINARHFRKPIDIWGNFIPGMIFFQSIFGYLVICII
YKWSVQWIDVQKGEVIAQPPGLLNMLIYMFLQPGTLDVRLYWGQEVVQVFLLLLAFVQVPILLFLKPFFLRWEHN
RARARGYRGIGETSRVSALDGDDEHMANGHGNSIDDDDDDDDGEGVAMISQDLGGGEHEEFDFGEVMIHQVIHTI
EFCLNCVSHTASYLRLWALSLAHQQLSVVLWDMTLGLALKQSGVVGVVMIVIFFYVWFFLTIAILVCMEGTSAML
HSLRLAWVESFSKFAEFAGWPFAPFSFSTLLEESEELKEYLG
Coding >Ophio5|8598
ATGGCCCCAAAGCAGGACACGCCGTTCCGCTCGGCGGACATGAGCATGGTCCAGCTGTACGTCTCCAACGAAATC
GGCCGCGAGGTTGTTACGGCCCTCGGTGAGCTTGGACTGTGTCAGTTTCGAGACTTGAATGAGCAAGTCAGCGCC
TTTCAAAGGACATACACCCAAGAGATTCGTCGTCTGGATAACGTCGACAGACAGCTCCGTTATTTCTACGCGCAG
ATGGAAAAGGCCGGCATCGGTCTCAAGAAACTCGACTTGGACAAGGAGAGGCTGGCATCTCCCTCGACGGCGGAG
ATTGACGAGCTGGCCGAGCGCAGCCAGACGCTCGAGCAGCGCATCTCGGCACTCAACGATAGTTACGAGACGCTC
AAGAAACGTGAAGGCGACCTGACCGAGTGGCGCTGGGTCCTGCGCGAGGCCGGAAGCTTCTTTGACCGTGCTCAC
GGCAACGTCGAAGAGATCCGCGCCTCGACCGACAACGACGATGCGCCCCTACTCTCCGACGTCGAGCAACATAAC
GCGGCGCCCGAAGTTGAGAGATCTTTCTCGGGTATGAACATTGGCTTCGTCGCCGGCGTCATCGCTAGGGAGCGT
GTCGCTGCCTTTGAGCGCATCCTCTGGCGGACCCTGCGTGGCAACCTTTACATGAACCAGTCCGAGATTCCCGAG
CAACTCATCGACCCGTCCAACAACGAGGCTATCCAGAAGAACGTCTTCGTCATCTTTGCTCACGGCAAGGAGATT
CTCGCCAAGATCCGCAAGATCTCGGAATCCATGGGGGCCGACGTTTACAGCGTCGACGAGAACAGCGACCTGCGA
CGCGACCAGATACACGAGGTCAACAACCGGCTCGACGACGTTCAGAGCGTCCTCCGCAACACGCAGGCGACGCTC
GAGGCCGAGCTGAGCCAGATCTCGCAGTCCCTGTCCGCCTGGATGGTCCTCGTCGCCAAGGAAAAGGCCGTCTAC
AGCACGCTGAACCTCTTCTCCTACGATCGTGCTCGCCGTACTCTCATCGCCGAGGCGTGGTGCCCCACCAACGAT
CTGCCGCTCATCCGTTCCACTCTCCAGGACGTCACCAACCGAGCCGGTCTATCCATTCCGTCCATCATCAACCAG
ATCCGGACGAACAAGACGCCGCCCACCTACATCAAGACCAACAAGTTTACCGAGGGCTTTCAGACCATCGTCAAC
GCGTACGGCACCGCCACCTACCAGGAGGTCAACCCGGCCATGCCCGTCATCGTCACGTTCCCCTTCCTTTTTGCC
GTCATGTTTGGCGACTTTGGCCATGCCATCATCATGCTGTCGGCTGCTCTGGCCATGATCTACTGGGAGAAGGCG
CTCAAGAAGGTGACGTTTGAGCTGTTTGCCATGGTCTTCTACGGCCGGTACATTGCCCTGGTCATGGCTGTCTTC
TCCATCTTCACCGGGCTCATCTACAACGACTCGTTTTCCAAGTCCATGACGCTATTCGACAGTGCGTGGGCCTAT
AAGAAGCCGGACGGGTGGAAGGAGGGCCAGACGGTCGATGCTCAGCTCAACTCGGACGGCTACCGCTATCCCTTT
GGCATCGACTGGGCCTGGCACGGCACCGACAACGAACTCCTCTTCAGCAACAGCTTCAAGATGAAGATGAGCATC
ATCCTCGGCTGGGCTCACATGACGTACTCGCTTTGCTTTGCCTACATCAACGCCCGCCACTTTAGGAAGCCCATC
GACATCTGGGGCAACTTTATTCCCGGCATGATCTTCTTCCAAAGCATCTTCGGCTACCTCGTCATCTGCATCATT
TACAAGTGGTCCGTTCAGTGGATCGACGTCCAGAAGGGCGAGGTCATCGCCCAGCCTCCAGGCCTCCTCAACATG
CTCATCTACATGTTCCTACAGCCGGGGACGCTGGACGTACGCCTCTACTGGGGCCAGGAGGTGGTCCAGGTCTTC
CTGCTACTTTTGGCCTTTGTGCAGGTGCCCATCCTGCTCTTTCTCAAGCCCTTCTTCCTCCGGTGGGAACACAAC
CGGGCCAGGGCCAGGGGATATCGTGGCATAGGAGAAACATCCCGCGTTAGCGCCCTGGATGGTGACGACGAGCAC
ATGGCCAACGGGCACGGAAACAGTATCGACGACGACGACGACGACGACGACGGGGAGGGCGTGGCTATGATCTCG
CAGGACCTCGGCGGCGGCGAGCACGAAGAGTTTGACTTTGGCGAGGTCATGATTCACCAAGTCATCCACACCATC
GAATTCTGCCTCAACTGCGTCTCCCACACGGCCTCGTACCTGCGACTCTGGGCCCTGTCGCTCGCCCACCAGCAG
CTCAGCGTCGTGCTGTGGGACATGACGCTGGGCCTGGCACTGAAGCAGTCTGGCGTCGTTGGCGTCGTGATGATT
GTCATCTTCTTTTACGTCTGGTTCTTCCTCACCATCGCCATCCTTGTGTGCATGGAGGGCACGAGCGCCATGCTG
CACTCGCTCCGGCTGGCGTGGGTCGAGTCGTTTTCCAAGTTTGCCGAGTTCGCCGGCTGGCCGTTTGCGCCCTTT
TCTTTTTCTACCTTGCTGGAGGAGTCGGAGGAGTTGAAGGAGTATTTGGGT
Transcript >Ophio5|8598
ATGGCCCCAAAGCAGGACACGCCGTTCCGCTCGGCGGACATGAGCATGGTCCAGCTGTACGTCTCCAACGAAATC
GGCCGCGAGGTTGTTACGGCCCTCGGTGAGCTTGGACTGTGTCAGTTTCGAGACTTGAATGAGCAAGTCAGCGCC
TTTCAAAGGACATACACCCAAGAGATTCGTCGTCTGGATAACGTCGACAGACAGCTCCGTTATTTCTACGCGCAG
ATGGAAAAGGCCGGCATCGGTCTCAAGAAACTCGACTTGGACAAGGAGAGGCTGGCATCTCCCTCGACGGCGGAG
ATTGACGAGCTGGCCGAGCGCAGCCAGACGCTCGAGCAGCGCATCTCGGCACTCAACGATAGTTACGAGACGCTC
AAGAAACGTGAAGGCGACCTGACCGAGTGGCGCTGGGTCCTGCGCGAGGCCGGAAGCTTCTTTGACCGTGCTCAC
GGCAACGTCGAAGAGATCCGCGCCTCGACCGACAACGACGATGCGCCCCTACTCTCCGACGTCGAGCAACATAAC
GCGGCGCCCGAAGTTGAGAGATCTTTCTCGGGTATGAACATTGGCTTCGTCGCCGGCGTCATCGCTAGGGAGCGT
GTCGCTGCCTTTGAGCGCATCCTCTGGCGGACCCTGCGTGGCAACCTTTACATGAACCAGTCCGAGATTCCCGAG
CAACTCATCGACCCGTCCAACAACGAGGCTATCCAGAAGAACGTCTTCGTCATCTTTGCTCACGGCAAGGAGATT
CTCGCCAAGATCCGCAAGATCTCGGAATCCATGGGGGCCGACGTTTACAGCGTCGACGAGAACAGCGACCTGCGA
CGCGACCAGATACACGAGGTCAACAACCGGCTCGACGACGTTCAGAGCGTCCTCCGCAACACGCAGGCGACGCTC
GAGGCCGAGCTGAGCCAGATCTCGCAGTCCCTGTCCGCCTGGATGGTCCTCGTCGCCAAGGAAAAGGCCGTCTAC
AGCACGCTGAACCTCTTCTCCTACGATCGTGCTCGCCGTACTCTCATCGCCGAGGCGTGGTGCCCCACCAACGAT
CTGCCGCTCATCCGTTCCACTCTCCAGGACGTCACCAACCGAGCCGGTCTATCCATTCCGTCCATCATCAACCAG
ATCCGGACGAACAAGACGCCGCCCACCTACATCAAGACCAACAAGTTTACCGAGGGCTTTCAGACCATCGTCAAC
GCGTACGGCACCGCCACCTACCAGGAGGTCAACCCGGCCATGCCCGTCATCGTCACGTTCCCCTTCCTTTTTGCC
GTCATGTTTGGCGACTTTGGCCATGCCATCATCATGCTGTCGGCTGCTCTGGCCATGATCTACTGGGAGAAGGCG
CTCAAGAAGGTGACGTTTGAGCTGTTTGCCATGGTCTTCTACGGCCGGTACATTGCCCTGGTCATGGCTGTCTTC
TCCATCTTCACCGGGCTCATCTACAACGACTCGTTTTCCAAGTCCATGACGCTATTCGACAGTGCGTGGGCCTAT
AAGAAGCCGGACGGGTGGAAGGAGGGCCAGACGGTCGATGCTCAGCTCAACTCGGACGGCTACCGCTATCCCTTT
GGCATCGACTGGGCCTGGCACGGCACCGACAACGAACTCCTCTTCAGCAACAGCTTCAAGATGAAGATGAGCATC
ATCCTCGGCTGGGCTCACATGACGTACTCGCTTTGCTTTGCCTACATCAACGCCCGCCACTTTAGGAAGCCCATC
GACATCTGGGGCAACTTTATTCCCGGCATGATCTTCTTCCAAAGCATCTTCGGCTACCTCGTCATCTGCATCATT
TACAAGTGGTCCGTTCAGTGGATCGACGTCCAGAAGGGCGAGGTCATCGCCCAGCCTCCAGGCCTCCTCAACATG
CTCATCTACATGTTCCTACAGCCGGGGACGCTGGACGTACGCCTCTACTGGGGCCAGGAGGTGGTCCAGGTCTTC
CTGCTACTTTTGGCCTTTGTGCAGGTGCCCATCCTGCTCTTTCTCAAGCCCTTCTTCCTCCGGTGGGAACACAAC
CGGGCCAGGGCCAGGGGATATCGTGGCATAGGAGAAACATCCCGCGTTAGCGCCCTGGATGGTGACGACGAGCAC
ATGGCCAACGGGCACGGAAACAGTATCGACGACGACGACGACGACGACGACGGGGAGGGCGTGGCTATGATCTCG
CAGGACCTCGGCGGCGGCGAGCACGAAGAGTTTGACTTTGGCGAGGTCATGATTCACCAAGTCATCCACACCATC
GAATTCTGCCTCAACTGCGTCTCCCACACGGCCTCGTACCTGCGACTCTGGGCCCTGTCGCTCGCCCACCAGCAG
CTCAGCGTCGTGCTGTGGGACATGACGCTGGGCCTGGCACTGAAGCAGTCTGGCGTCGTTGGCGTCGTGATGATT
GTCATCTTCTTTTACGTCTGGTTCTTCCTCACCATCGCCATCCTTGTGTGCATGGAGGGCACGAGCGCCATGCTG
CACTCGCTCCGGCTGGCGTGGGTCGAGTCGTTTTCCAAGTTTGCCGAGTTCGCCGGCTGGCCGTTTGCGCCCTTT
TCTTTTTCTACCTTGCTGGAGGAGTCGGAGGAGTTGAAGGAGTATTTGGGTTGA
Gene >Ophio5|8598
ATGGCCCCAAAGCAGGACACGCCGTTCCGCTCGGCGGACATGAGCATGGTCCAGCTGTACGTCTCCAACGAAATC
GGCCGCGAGGTTGTTACGGCCCTCGGTGAGCTTGGACTGTGTCAGTTTCGAGACGTATGTCATCCATCCGTAACC
TCCCGTTTCTGGCTTCCCTCGGCTTACACATGGTCCAACGAAGTTGAATGAGCAAGTCAGCGCCTTTCAAAGGAC
ATACACCCAAGAGATTCGTCGTCTGGATAACGTCGACAGACAGCTCCGTATGTGCCTCCGGAACCCCCGTCGCCC
AACACGCATCCTGACCAGACGCAGGTTATTTCTACGCGCAGATGGAAAAGGCCGGCATCGGTCTCAAGAAACTCG
ACTTGGACAAGGAGAGGCTGGCATCTCCCTCGACGGCGGAGATTGACGAGCTGGCCGAGCGCAGCCAGACGCTCG
AGCAGCGCATCTCGGCACTCAACGATAGTTACGAGACGCTCAAGAAACGTGAAGGCGACCTGACCGAGTGGCGCT
GGGTCCTGCGCGAGGCCGGAAGCTTCTTTGACCGTGCTCACGGCAACGTCGAAGAGATCCGCGCCTCGACCGACA
ACGACGATGCGCCCCTACTCTCCGACGTCGAGCAACATAACGCGGCGCCCGAAGTTGAGAGATCTTTCTCGGGTA
TGAACATTGGCTTCGTCGCCGGCGTCATCGCTAGGGAGCGTGTCGCTGCCTTTGAGCGCATCCTCTGGCGGACCC
TGCGTGGCAACCTTTACATGAACCAGTCCGAGATTCCCGAGCAACTCATCGACCCGTCCAACAACGAGGCTATCC
AGAAGAACGTCTTCGTCATCTTTGCTCACGGCAAGGAGATTCTCGCCAAGATCCGCAAGATCTCGGAATCCATGG
GGGCCGACGTTTACAGCGTCGACGAGAACAGCGACCTGCGACGCGACCAGATACACGAGGTCAACAACCGGCTCG
ACGACGTTCAGAGCGTCCTCCGCAACACGCAGGCGACGCTCGAGGCCGAGCTGAGCCAGATCTCGCAGTCCCTGT
CCGCCTGGATGGTCCTCGTCGCCAAGGAAAAGGCCGTCTACAGCACGCTGAACCTCTTCTCCTACGATCGTGCTC
GCCGTACTCTCATCGCCGAGGCGTGGTGCCCCACCAACGATCTGCCGCTCATCCGTTCCACTCTCCAGGACGTCA
CCAACCGAGCCGGTCTATCCATTCCGTCCATCATCAACCAGATCCGGACGAACAAGACGCCGCCCACCTACATCA
AGACCAACAAGTTTACCGAGGGCTTTCAGACCATCGTCAACGCGTACGGCACCGCCACCTACCAGGAGGTCAACC
CGGCCATGCCCGTCATCGTCACGTTCCCCTTCCTTTTTGCCGTCATGTTTGGCGACTTTGGCCATGCCATCATCA
TGCTGTCGGCTGCTCTGGCCATGATCTACTGGGAGAAGGCGCTCAAGAAGGTGACGTTTGAGCTGTTTGCCATGG
TCTTCTACGGCCGGTACATTGCCCTGGTCATGGCTGTCTTCTCCATCTTCACCGGGCTCATCTACAACGACTCGT
TTTCCAAGTCCATGACGCTATTCGACAGTGCGTGGGCCTATAAGAAGCCGGACGGGTGGAAGGAGGGCCAGACGG
TCGATGCTCAGCTCAACTCGGACGGCTACCGCTATCCCTTTGGCATCGACTGGGCCTGGCACGGCACCGACAACG
AACTCCTCTTCAGCAACAGCTTCAAGATGAAGATGAGCATCATCCTCGGCTGGGCTCACATGACGTACTCGCTTT
GCTTTGCCTACATCAACGCCCGCCACTTTAGGAAGCCCATCGACATCTGGGGCAACTTTATTCCCGGCATGATCT
TCTTCCAAAGCATCTTCGGCTACCTCGTCATCTGCATCATTTACAAGTGGTCCGTTCAGTGGATCGACGTCCAGA
AGGGCGAGGTCATCGCCCAGCCTCCAGGCCTCCTCAACATGCTCATCTACATGTTCCTACAGCCGGGGACGCTGG
ACGTACGCCTCTACTGGGGCCAGGAGGTGGTCCAGGTCTTCCTGCTACTTTTGGCCTTTGTGCAGGTGCCCATCC
TGCTCTTTCTCAAGCCCTTCTTCCTCCGGTGGGAACACAACCGGGCCAGGGCCAGGGGATATCGTGGCATAGGAG
AAACATCCCGCGTTAGCGCCCTGGATGGTGACGACGAGCACATGGCCAACGGGCACGGAAACAGTATCGACGACG
ACGACGACGACGACGACGGGGAGGGCGTGGCTATGATCTCGCAGGACCTCGGCGGCGGCGAGCACGAAGAGTTTG
ACTTTGGCGAGGTCATGATTCACCAAGTCATCCACACCATCGAATTCTGCCTCAACTGCGTCTCCCACACGGCCT
CGTACCTGCGACTCTGGGCCCTGTCGCTCGCCCACCAGCAGCTCAGCGTCGTGCTGTGGGACATGACGCTGGGCC
TGGCACTGAAGCAGTCTGGCGTCGTTGGCGTCGTGATGATTGTCATCTTCTTTTACGTCTGGTTCTTCCTCAGTA
AGCGTTTTCCCCCTCCTCCTTTCTCCCTCTCTCTCTCTCTCTCTCTCTCCCTCTCTCCCTCTCTCCCTCTCTCCT
CTTTTCGGCTACGATGACTGACACCTTGGTTTTCCTTCCCCCTTCCTTCCCTCTCCCTTCCTTACAGCCATCGCC
ATCCTTGTGTGCATGGAGGGCACGAGCGCCATGCTGCACTCGCTCCGGCTGGCGTGGGTCGAGTCGTTTTCCAAG
TTTGCCGAGTTCGCCGGCTGGCCGTTTGCGCCCTTTTCTTTTTCTACCTTGCTGGAGGAGTCGGAGGAGTTGAAG
GAGTATTTGGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail