Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8593
Gene name
Locationscaffold_989:533..2466
Strand-
Gene length (bp)1933
Transcript length (bp)1818
Coding sequence length (bp)1815
Protein length (aa) 605

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11374 DUF3176 Protein of unknown function (DUF3176) 2.3E-22 90 203

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 71 93 22
2 103 125 22
3 516 538 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 63.97 34.84 93.11
CcL In ants, during behavior modification 42.08 23.00 61.17
CcD In ants, recently dead 43.99 23.83 64.15

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.061312 no
SC16a CcD 0.105765 no
CcL CcD 0.878640 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8593
MRLGATHLRPRNYLDSRTAATSNSPHDAASNSGVRGLFSCHDGAADDEVVENAELGINHISRRCRSPLNWWVVEY
WCAALCIAGITTLSLVLWRCDGKLSPDFGVGIKLDMIVIAIMTLVRVTLGSIVESCICQGAWIWVSKSHQTRTKN
KARLEDFKLFDEASRGFLGSAALLWRLKGMHISCIGAVIILVTHGLETFSQQMFVYVQAPTVSVSQMSRPAPAPF
RSDYWDNVSERGIQSGYSLTLSTKSAVYSGILAAQVRDLEPQCDTANCTWPVIPTLAICGHCDDAPVQVHCSSQS
NFCTFGISSDTNVTLPNRAEMDTFRVSPVNASLDDALEQGRTYVSVFEILTITKRQAATKMSGARCALWLCLKAY
NISVANGRSQQVLVATWNASRFEAATSAHTDEHVFTDIPKTLNTRPLSRYSVSDRSLKALRNFLESLTSGTFEHA
SNVINFSSDWIEAMWQATADLEVWIETLSQSLTNEFREHGTIRDPYETDYEGSASRMANYVHVKWLWMVYPVLIL
VTSLYYLLLTIVAGARDGVLAWKCDSLPMLFSRIHPSILALGSDKMNEPRGLDDLGKSRVALTKDENGFWTFEPS
DWKNE
Coding >Ophio5|8593
ATGAGGCTAGGTGCAACGCATCTGCGCCCGCGGAATTACCTCGACAGCCGAACCGCTGCTACCAGCAACAGTCCG
CATGACGCCGCCTCCAACTCTGGCGTACGAGGATTGTTTTCATGCCACGATGGTGCAGCCGACGACGAAGTTGTC
GAGAATGCTGAGCTTGGGATAAACCATATCTCTCGGCGATGCCGCTCTCCCCTCAATTGGTGGGTCGTCGAGTAC
TGGTGCGCCGCTTTGTGCATCGCTGGCATCACCACTCTCTCCCTCGTGTTGTGGCGTTGCGATGGCAAATTATCA
CCAGATTTCGGCGTCGGCATCAAGCTTGACATGATCGTCATCGCCATCATGACCCTCGTCCGGGTCACCCTCGGA
AGTATCGTCGAGTCTTGTATCTGCCAAGGAGCCTGGATTTGGGTTTCCAAGTCGCACCAGACTCGTACCAAAAAC
AAAGCTAGGCTCGAGGACTTCAAGCTGTTTGACGAGGCATCACGAGGTTTCCTTGGCAGTGCAGCCTTACTATGG
CGTCTCAAGGGAATGCATATATCTTGCATCGGGGCTGTGATTATACTAGTGACGCATGGCTTGGAGACGTTTTCC
CAGCAGATGTTTGTCTACGTTCAAGCACCGACAGTTTCTGTTAGCCAAATGTCTCGGCCGGCCCCTGCCCCTTTC
CGAAGCGACTATTGGGACAACGTTTCCGAGAGAGGGATTCAGAGTGGCTACTCGCTTACGCTGTCGACCAAATCA
GCCGTTTATAGTGGCATCCTAGCTGCCCAGGTTCGCGATCTCGAACCACAATGCGATACGGCCAACTGCACATGG
CCTGTTATCCCAACCCTTGCGATCTGCGGCCACTGTGATGACGCCCCCGTTCAAGTTCATTGCTCGAGCCAGTCG
AACTTCTGTACGTTCGGCATCTCGAGCGATACAAACGTCACCTTGCCCAACCGTGCAGAGATGGACACATTCCGC
GTGAGCCCTGTGAACGCGAGCCTTGATGACGCCTTGGAGCAGGGAAGGACCTATGTATCCGTTTTTGAGATCCTG
ACCATAACCAAACGTCAGGCCGCAACTAAAATGAGCGGGGCGAGGTGTGCACTGTGGCTATGCCTCAAAGCATAC
AACATCTCCGTGGCCAACGGCCGATCGCAGCAAGTTCTTGTGGCTACGTGGAATGCGAGCCGATTCGAGGCAGCA
ACAAGTGCTCATACCGACGAGCACGTATTTACGGATATTCCGAAAACGTTGAACACGCGCCCATTATCGAGGTAC
AGCGTATCCGACCGCTCCCTGAAGGCCCTGCGCAACTTTCTGGAGTCTTTGACCAGCGGGACGTTCGAACATGCC
TCGAACGTCATAAATTTCTCGTCTGACTGGATCGAGGCCATGTGGCAAGCAACCGCCGATTTAGAGGTATGGATC
GAGACACTTAGCCAAAGCTTAACAAATGAATTCCGCGAGCACGGGACAATCCGCGATCCCTATGAGACAGATTAT
GAAGGGAGCGCCTCGAGAATGGCCAACTATGTCCACGTAAAGTGGCTTTGGATGGTATATCCAGTCCTGATCCTT
GTCACCAGCCTGTACTATCTCCTTCTCACCATCGTCGCCGGAGCTCGCGACGGGGTTTTAGCCTGGAAGTGTGAT
TCCCTGCCTATGTTGTTCAGCCGAATTCACCCGAGTATCCTGGCTTTGGGTTCAGACAAAATGAACGAGCCCAGG
GGTTTGGACGATCTTGGCAAATCAAGAGTGGCTTTAACTAAAGATGAGAACGGGTTTTGGACCTTCGAACCAAGC
GATTGGAAGAACGAG
Transcript >Ophio5|8593
ATGAGGCTAGGTGCAACGCATCTGCGCCCGCGGAATTACCTCGACAGCCGAACCGCTGCTACCAGCAACAGTCCG
CATGACGCCGCCTCCAACTCTGGCGTACGAGGATTGTTTTCATGCCACGATGGTGCAGCCGACGACGAAGTTGTC
GAGAATGCTGAGCTTGGGATAAACCATATCTCTCGGCGATGCCGCTCTCCCCTCAATTGGTGGGTCGTCGAGTAC
TGGTGCGCCGCTTTGTGCATCGCTGGCATCACCACTCTCTCCCTCGTGTTGTGGCGTTGCGATGGCAAATTATCA
CCAGATTTCGGCGTCGGCATCAAGCTTGACATGATCGTCATCGCCATCATGACCCTCGTCCGGGTCACCCTCGGA
AGTATCGTCGAGTCTTGTATCTGCCAAGGAGCCTGGATTTGGGTTTCCAAGTCGCACCAGACTCGTACCAAAAAC
AAAGCTAGGCTCGAGGACTTCAAGCTGTTTGACGAGGCATCACGAGGTTTCCTTGGCAGTGCAGCCTTACTATGG
CGTCTCAAGGGAATGCATATATCTTGCATCGGGGCTGTGATTATACTAGTGACGCATGGCTTGGAGACGTTTTCC
CAGCAGATGTTTGTCTACGTTCAAGCACCGACAGTTTCTGTTAGCCAAATGTCTCGGCCGGCCCCTGCCCCTTTC
CGAAGCGACTATTGGGACAACGTTTCCGAGAGAGGGATTCAGAGTGGCTACTCGCTTACGCTGTCGACCAAATCA
GCCGTTTATAGTGGCATCCTAGCTGCCCAGGTTCGCGATCTCGAACCACAATGCGATACGGCCAACTGCACATGG
CCTGTTATCCCAACCCTTGCGATCTGCGGCCACTGTGATGACGCCCCCGTTCAAGTTCATTGCTCGAGCCAGTCG
AACTTCTGTACGTTCGGCATCTCGAGCGATACAAACGTCACCTTGCCCAACCGTGCAGAGATGGACACATTCCGC
GTGAGCCCTGTGAACGCGAGCCTTGATGACGCCTTGGAGCAGGGAAGGACCTATGTATCCGTTTTTGAGATCCTG
ACCATAACCAAACGTCAGGCCGCAACTAAAATGAGCGGGGCGAGGTGTGCACTGTGGCTATGCCTCAAAGCATAC
AACATCTCCGTGGCCAACGGCCGATCGCAGCAAGTTCTTGTGGCTACGTGGAATGCGAGCCGATTCGAGGCAGCA
ACAAGTGCTCATACCGACGAGCACGTATTTACGGATATTCCGAAAACGTTGAACACGCGCCCATTATCGAGGTAC
AGCGTATCCGACCGCTCCCTGAAGGCCCTGCGCAACTTTCTGGAGTCTTTGACCAGCGGGACGTTCGAACATGCC
TCGAACGTCATAAATTTCTCGTCTGACTGGATCGAGGCCATGTGGCAAGCAACCGCCGATTTAGAGGTATGGATC
GAGACACTTAGCCAAAGCTTAACAAATGAATTCCGCGAGCACGGGACAATCCGCGATCCCTATGAGACAGATTAT
GAAGGGAGCGCCTCGAGAATGGCCAACTATGTCCACGTAAAGTGGCTTTGGATGGTATATCCAGTCCTGATCCTT
GTCACCAGCCTGTACTATCTCCTTCTCACCATCGTCGCCGGAGCTCGCGACGGGGTTTTAGCCTGGAAGTGTGAT
TCCCTGCCTATGTTGTTCAGCCGAATTCACCCGAGTATCCTGGCTTTGGGTTCAGACAAAATGAACGAGCCCAGG
GGTTTGGACGATCTTGGCAAATCAAGAGTGGCTTTAACTAAAGATGAGAACGGGTTTTGGACCTTCGAACCAAGC
GATTGGAAGAACGAGTAA
Gene >Ophio5|8593
ATGAGGCTAGGTGCAACGCATCTGCGCCCGCGGAATTACCTCGACAGCCGAACCGCTGCTACCAGCAACAGTCCG
CATGACGCCGCCTCCAACTCTGGCGTACGAGGATTGTTTTCATGCCACGATGGTGCAGCCGACGACGAAGTTGTC
GAGAATGCTGAGCTTGGGATAAACCATATCTCTCGGCGATGCCGCTCTCCCCTCAATTGGTGGGTCGTCGAGTAC
TGGTGCGCCGCTTTGTGCATCGCTGGCATCACCACTCTCTCCCTCGTGTTGTGGCGTTGCGATGGCAAATTATCA
CCAGATTTCGGCGTCGGCATCAAGCTTGACATGATCGTCATCGCCATCATGACCCTCGTCCGGGTCACCCTCGGA
AGTATCGTCGAGTCTTGTATCTGCCAAGGAGCCTGGATTTGGGTTTCCAAGTCGCACCAGACTCGTACCAAAAAC
AAAGCTAGGCTCGAGGACTTCAAGCTGTTTGACGAGGCATCACGAGGTTTCCTTGGCAGTGCAGCCTTACTATGG
CGTCTCAAGGGAATGTCGGTCCTCCCCAATCCGTTACCAGTTCTGGAAATCGAGTCTAACCGCCGCTTCCGTAGG
CATATATCTTGCATCGGGGCTGTGATTATACTAGTGACGCATGGCTTGGAGACGTTTTCCCAGCAGATGTTTGTC
TACGTTCAAGCACCGACAGTTTCTGTTAGCCAAATGTCTCGGCCGGCCCCTGCCCCTTTCCGAAGCGACTATTGG
GACAACGTTTCCGAGAGAGGGATTCAGAGTGGTATGTTTTTGGGTAAATACAAGCTACATGTGCCCTGCCACTGA
AAACGACGCAGGCTACTCGCTTACGCTGTCGACCAAATCAGCCGTTTATAGTGGCATCCTAGCTGCCCAGGTTCG
CGATCTCGAACCACAATGCGATACGGCCAACTGCACATGGCCTGTTATCCCAACCCTTGCGATCTGCGGCCACTG
TGATGACGCCCCCGTTCAAGTTCATTGCTCGAGCCAGTCGAACTTCTGTACGTTCGGCATCTCGAGCGATACAAA
CGTCACCTTGCCCAACCGTGCAGAGATGGACACATTCCGCGTGAGCCCTGTGAACGCGAGCCTTGATGACGCCTT
GGAGCAGGGAAGGACCTATGTATCCGTTTTTGAGATCCTGACCATAACCAAACGTCAGGCCGCAACTAAAATGAG
CGGGGCGAGGTGTGCACTGTGGCTATGCCTCAAAGCATACAACATCTCCGTGGCCAACGGCCGATCGCAGCAAGT
TCTTGTGGCTACGTGGAATGCGAGCCGATTCGAGGCAGCAACAAGTGCTCATACCGACGAGCACGTATTTACGGA
TATTCCGAAAACGTTGAACACGCGCCCATTATCGAGGTACAGCGTATCCGACCGCTCCCTGAAGGCCCTGCGCAA
CTTTCTGGAGTCTTTGACCAGCGGGACGTTCGAACATGCCTCGAACGTCATAAATTTCTCGTCTGACTGGATCGA
GGCCATGTGGCAAGCAACCGCCGATTTAGAGGTATGGATCGAGACACTTAGCCAAAGCTTAACAAATGAATTCCG
CGAGCACGGGACAATCCGCGATCCCTATGAGACAGATTATGAAGGGAGCGCCTCGAGAATGGCCAACTATGTCCA
CGTAAAGTGGCTTTGGATGGTATATCCAGTCCTGATCCTTGTCACCAGCCTGTACTATCTCCTTCTCACCATCGT
CGCCGGAGCTCGCGACGGGGTTTTAGCCTGGAAGTGTGATTCCCTGCCTATGTTGTTCAGCCGAATTCACCCGAG
TATCCTGGCTTTGGGTTCAGACAAAATGAACGAGCCCAGGGGTTTGGACGATCTTGGCAAATCAAGAGTGGCTTT
AACTAAAGATGAGAACGGGTTTTGGACCTTCGAACCAAGCGATTGGAAGAACGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail