Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|859
Gene name
Locationscaffold_125:34987..37504
Strand+
Gene length (bp)2517
Transcript length (bp)1905
Coding sequence length (bp)1902
Protein length (aa) 634

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00855 PWWP PWWP domain 3.5E-13 144 250

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94312|PDP2_SCHPO PWWP domain-containing protein2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdp2 PE=1 SV=1 392 489 9.0E-09
sp|Q09842|PDP3_SCHPO PWWP domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdp3 PE=1 SV=1 308 500 3.0E-08
sp|O59676|PDP1_SCHPO PWWP domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdp1 PE=1 SV=1 397 489 9.0E-06

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2774 0.8273 0.3068 0.0702 0.0376 0.0079 0.0221 0.0096 0.0156 0.0006

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3521
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4222
Ophiocordyceps australis map64 (Brazil) OphauB2|1853
Ophiocordyceps camponoti-floridani Ophcf2|04555
Ophiocordyceps camponoti-rufipedis Ophun1|4479
Ophiocordyceps kimflemingae Ophio5|859 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6748

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|859
MADKPTDKAEAAAPVDKAASPAPQDDGQELGDKEPSKLEDKGVAESATKVSSEPDVPENGAAAAKGEGAADKTAA
EPAKEQEKEKPDTDVEMKDAVEDAAPEPGPAPAKAKGGRRKSSLGEAKGKSLAKKGSKARLTHVDAKPGDHFLVK
LKGHPAWPAIVCDETMLPAALISSRPVSAARPDGSYTEAYAEGGKRVHDRSFPVMYLYTNEFGWAQNSTLSALTI
DKAKDAVTEKMRKDLRAAYELAAEHNPVEHYKEILQSFQEEQIAQEEARKQTVTLKKAKKGKGKALDDDDMDMDM
DDAHVVPKSAKSKKRKADDDTNTPQRPESIKKPKIKLNTSSTPKTANGAATPKSAGASAAKSSKSKPKKAKDGGE
KKTETPKEVKMTPEERHARKEREVLYLRHKLQRGLLTREQQPREDEMKTMSDFITVLENMVDLEVSIIRATKINK
VLKAILKLDSIPREEEFVFKKRSQSLLDKWNKLLADDSSAGPAASTNGVNGAEEKRSKANGTKDDADEAIKAEPD
KTEEDKAEPDKAEPDKAEEDKAEPRNAEGKAREKGGEGDSTNKEEATENKAEDAEDEAEANKVKTEAAEDKAESA
ECKAVKVSSPAVDVPAEARCLALIKRMAMTQAPY
Coding >Ophio5|859
ATGGCCGACAAGCCGACGGACAAGGCTGAAGCGGCTGCGCCTGTCGACAAGGCTGCGTCGCCCGCGCCCCAGGAC
GACGGGCAGGAACTGGGCGATAAGGAGCCGTCCAAGCTCGAGGACAAGGGCGTTGCGGAAAGTGCCACGAAGGTC
TCCTCTGAACCCGACGTGCCCGAAAACGGAGCGGCAGCTGCCAAAGGAGAGGGAGCGGCCGACAAGACAGCGGCA
GAACCGGCAAAGGAACAGGAAAAGGAAAAGCCCGACACCGACGTTGAGATGAAAGACGCTGTCGAGGATGCGGCA
CCGGAGCCTGGGCCCGCCCCCGCCAAAGCCAAAGGCGGCCGTCGCAAGTCGAGCCTCGGTGAGGCCAAGGGCAAG
TCGCTGGCCAAGAAGGGATCCAAGGCGCGTCTCACCCACGTCGACGCGAAGCCTGGCGACCACTTCTTGGTCAAG
CTCAAGGGCCATCCGGCGTGGCCGGCCATTGTGTGCGACGAAACCATGCTGCCGGCCGCCCTGATCAGCAGTCGT
CCCGTCTCCGCCGCCAGACCAGACGGAAGCTACACCGAGGCTTACGCAGAAGGGGGCAAGCGTGTCCACGACAGA
AGCTTCCCCGTCATGTACTTGTACACCAACGAGTTCGGCTGGGCCCAGAACTCGACCCTCTCCGCGCTCACGATT
GACAAGGCCAAAGACGCCGTCACGGAAAAGATGCGCAAGGACCTAAGGGCCGCATACGAGCTCGCCGCCGAACAC
AATCCCGTCGAGCACTACAAGGAGATACTACAGTCCTTCCAGGAAGAGCAGATTGCACAGGAAGAGGCTCGAAAG
CAAACTGTCACTCTGAAGAAAGCCAAGAAGGGCAAGGGCAAAGCTCTAGATGACGACGACATGGACATGGACATG
GATGATGCTCATGTCGTCCCCAAGTCGGCCAAGTCTAAGAAGCGAAAGGCCGATGATGACACCAATACTCCTCAG
AGACCCGAATCGATCAAAAAACCCAAGATCAAGCTCAACACGTCTTCCACTCCCAAGACAGCAAACGGCGCCGCC
ACCCCCAAGTCGGCGGGTGCCTCTGCGGCCAAGTCCTCCAAGTCGAAGCCCAAGAAGGCCAAAGACGGAGGTGAG
AAAAAGACGGAAACACCCAAGGAGGTCAAGATGACTCCTGAGGAGCGTCATGCTCGGAAAGAGAGAGAGGTTCTC
TACCTCCGCCACAAACTCCAGCGGGGCCTCCTTACCAGGGAGCAGCAGCCGCGAGAGGATGAGATGAAGACAATG
TCGGACTTTATCACCGTTCTCGAGAACATGGTCGACCTCGAGGTCTCCATCATCAGGGCGACCAAGATCAACAAG
GTGCTCAAGGCTATCCTCAAGCTTGACTCTATTCCCCGCGAGGAGGAGTTTGTGTTCAAAAAGAGATCGCAGTCG
CTTCTCGACAAGTGGAACAAGCTTCTCGCCGACGATTCCTCGGCTGGCCCGGCGGCGTCGACCAACGGCGTCAAC
GGGGCGGAGGAGAAGAGGTCAAAGGCCAATGGCACCAAGGATGATGCCGACGAGGCGATCAAGGCCGAGCCCGAC
AAGACCGAGGAGGACAAGGCCGAGCCCGACAAGGCCGAGCCCGACAAGGCCGAGGAGGACAAGGCCGAGCCTAGG
AACGCTGAGGGGAAGGCCCGGGAGAAGGGCGGCGAGGGAGATTCAACCAACAAGGAGGAGGCCACTGAGAACAAG
GCGGAGGATGCGGAGGACGAGGCTGAGGCCAACAAGGTCAAGACGGAGGCCGCCGAAGACAAGGCGGAGTCTGCC
GAGTGCAAGGCGGTCAAGGTATCGTCTCCTGCAGTGGACGTTCCCGCCGAGGCTCGGTGCCTTGCTCTAATCAAA
CGGATGGCTATGACCCAGGCTCCATAT
Transcript >Ophio5|859
ATGGCCGACAAGCCGACGGACAAGGCTGAAGCGGCTGCGCCTGTCGACAAGGCTGCGTCGCCCGCGCCCCAGGAC
GACGGGCAGGAACTGGGCGATAAGGAGCCGTCCAAGCTCGAGGACAAGGGCGTTGCGGAAAGTGCCACGAAGGTC
TCCTCTGAACCCGACGTGCCCGAAAACGGAGCGGCAGCTGCCAAAGGAGAGGGAGCGGCCGACAAGACAGCGGCA
GAACCGGCAAAGGAACAGGAAAAGGAAAAGCCCGACACCGACGTTGAGATGAAAGACGCTGTCGAGGATGCGGCA
CCGGAGCCTGGGCCCGCCCCCGCCAAAGCCAAAGGCGGCCGTCGCAAGTCGAGCCTCGGTGAGGCCAAGGGCAAG
TCGCTGGCCAAGAAGGGATCCAAGGCGCGTCTCACCCACGTCGACGCGAAGCCTGGCGACCACTTCTTGGTCAAG
CTCAAGGGCCATCCGGCGTGGCCGGCCATTGTGTGCGACGAAACCATGCTGCCGGCCGCCCTGATCAGCAGTCGT
CCCGTCTCCGCCGCCAGACCAGACGGAAGCTACACCGAGGCTTACGCAGAAGGGGGCAAGCGTGTCCACGACAGA
AGCTTCCCCGTCATGTACTTGTACACCAACGAGTTCGGCTGGGCCCAGAACTCGACCCTCTCCGCGCTCACGATT
GACAAGGCCAAAGACGCCGTCACGGAAAAGATGCGCAAGGACCTAAGGGCCGCATACGAGCTCGCCGCCGAACAC
AATCCCGTCGAGCACTACAAGGAGATACTACAGTCCTTCCAGGAAGAGCAGATTGCACAGGAAGAGGCTCGAAAG
CAAACTGTCACTCTGAAGAAAGCCAAGAAGGGCAAGGGCAAAGCTCTAGATGACGACGACATGGACATGGACATG
GATGATGCTCATGTCGTCCCCAAGTCGGCCAAGTCTAAGAAGCGAAAGGCCGATGATGACACCAATACTCCTCAG
AGACCCGAATCGATCAAAAAACCCAAGATCAAGCTCAACACGTCTTCCACTCCCAAGACAGCAAACGGCGCCGCC
ACCCCCAAGTCGGCGGGTGCCTCTGCGGCCAAGTCCTCCAAGTCGAAGCCCAAGAAGGCCAAAGACGGAGGTGAG
AAAAAGACGGAAACACCCAAGGAGGTCAAGATGACTCCTGAGGAGCGTCATGCTCGGAAAGAGAGAGAGGTTCTC
TACCTCCGCCACAAACTCCAGCGGGGCCTCCTTACCAGGGAGCAGCAGCCGCGAGAGGATGAGATGAAGACAATG
TCGGACTTTATCACCGTTCTCGAGAACATGGTCGACCTCGAGGTCTCCATCATCAGGGCGACCAAGATCAACAAG
GTGCTCAAGGCTATCCTCAAGCTTGACTCTATTCCCCGCGAGGAGGAGTTTGTGTTCAAAAAGAGATCGCAGTCG
CTTCTCGACAAGTGGAACAAGCTTCTCGCCGACGATTCCTCGGCTGGCCCGGCGGCGTCGACCAACGGCGTCAAC
GGGGCGGAGGAGAAGAGGTCAAAGGCCAATGGCACCAAGGATGATGCCGACGAGGCGATCAAGGCCGAGCCCGAC
AAGACCGAGGAGGACAAGGCCGAGCCCGACAAGGCCGAGCCCGACAAGGCCGAGGAGGACAAGGCCGAGCCTAGG
AACGCTGAGGGGAAGGCCCGGGAGAAGGGCGGCGAGGGAGATTCAACCAACAAGGAGGAGGCCACTGAGAACAAG
GCGGAGGATGCGGAGGACGAGGCTGAGGCCAACAAGGTCAAGACGGAGGCCGCCGAAGACAAGGCGGAGTCTGCC
GAGTGCAAGGCGGTCAAGGTATCGTCTCCTGCAGTGGACGTTCCCGCCGAGGCTCGGTGCCTTGCTCTAATCAAA
CGGATGGCTATGACCCAGGCTCCATATTGA
Gene >Ophio5|859
ATGGCCGACAAGCCGACGGACAAGGCTGAAGCGGCTGCGCCTGTCGACAAGGCTGCGTCGCCCGCGCCCCAGGAC
GACGGGCAGGAACTGGGCGATAAGGAGCCGTCCAAGCTCGAGGACAAGGGCGTTGCGGAAAGTGCCACGAAGGTC
TCCTCTGGTGAGTTTTCGGGGCAATGATGGTGCAAGGCATGACGCGTCGGTTTCGTCTCTTGGTTTTTTTTTTTT
CCTTCTCTTTCCCTTCTCACTCATCTTTGCTCTTCCCTGTTGCTTCTCTCTCCCCTTTGTTTACGGCCAATTCTC
CCGCAAGAGTTCTCCATCTGTTACTTACTTCCCCCTCTCCTTGGGCGCTTGGGAACGCTTCCGTTTTTGCGGCTA
AAATCGGGCTGACGAGGCTCTCGATCAGAACCCGACGTGCCCGAAAACGGAGCGGCAGCTGCCAAAGGAGAGGGA
GCGGCCGACAAGACAGCGGCAGAACCGGCAAAGGAACAGGAAAAGGAAAAGCCCGACACCGACGTTGAGATGAAA
GACGCTGTCGAGGATGCGGCACCGGAGCCTGGGCCCGCCCCCGCCAAAGCCAAAGGCGGCCGTCGCAAGTCGAGC
CTCGGTGAGGCCAAGGGCAAGTCGCTGGCCAAGAAGGGATCCAAGGCGCGTCTCACCCACGTCGACGCGAAGCCT
GGCGACCACTTCTTGGTCAAGCTCAAGGGCCATCCGGCGTGGCCGGCCATTGTGTGCGACGAAACCATGCTGCCG
GCCGCCCTGATCAGCAGTCGTCCCGTCTCCGCCGCCAGACCAGACGGAAGCTACACCGAGGCTTACGCAGAAGGG
GGCAAGCGTGTCCACGACAGAAGCTTCCCCGTCATGTACTTGTACACCAACGAGTTGTGAGTTGCGCAGAGACGA
CAGACTTGGCCGGCGCGCGCTTTACTGACTTGGCCTTTGCAGCGGCTGGGCCCAGAACTCGACCCTCTCCGCGCT
CACGATTGACAAGGCCAAAGACGCCGTCACGGAAAAGATGCGCAAGGACCTAAGGGCCGCATACGAGCTCGCCGC
CGAACACAATCCCGTCGAGCACTACAAGGAGATACTACAGTCCTTCCAGGAAGAGCAGATTGCACAGGAAGAGGC
TCGAAAGCAAACTGTCACTCTGAAGAAAGCCAAGAAGGGCAAGGGCAAAGCTCTAGATGACGACGACATGGACAT
GGACATGGATGATGCTCATGTCGTCCCCAAGTCGGCCAAGTCTAAGAAGCGAAAGGCCGATGATGACACCAATGT
GAGTCTTTCCAGCGTCGGGGGGGGGCTTTGCGGGCTAACATGCCGACGATGCAGACTCCTCAGAGACCCGAATCG
ATCAAAAAACCCAAGATCAAGCTCAACACGTCTTCCACTCCCAAGACAGCAAACGGCGCCGCCACCCCCAAGTCG
GCGGGTGCCTCTGCGGCCAAGTCCTCCAAGTCGAAGCCCAAGAAGGCCAAAGACGGAGGTGAGAAAAAGACGGAA
ACACCCAAGGAGGTCAAGATGACTCCTGAGGAGCGTCATGCTCGGAAAGAGGTACGTGGCCAGGAATTGCGGTCG
GAGAGGAGCAGCCTTAACAATGTCGCAGAGAGAGGTTCTCTACCTCCGCCACAAACTCCAGCGGGGCCTCCTTAC
CAGGGAGCAGCAGCCGCGAGAGGATGAGATGAAGACAATGTCGGACTTTATCACCGTTCTCGAGAACATGGTCGA
CCTCGAGGTCTCCATCATCAGGGCGACCAAGATCAACAAGGTGCTCAAGGCTATCCTCAAGCTTGACTCTATTCC
CCGCGAGGAGGAGTTTGTGTTCAAAAAGAGATCGCAGTCGCTTCTCGACAAGTGGAACAAGCTTCTCGCCGACGA
TTCCTCGGCTGGCCCGGCGGCGTCGACCAACGGCGTCAACGGGGCGGAGGAGAAGAGGTCAAAGGCCAATGGCAC
CAAGGATGATGCCGACGAGGCGATCAAGGCCGAGCCCGACAAGACCGAGGAGGACAAGGCCGAGCCCGACAAGGC
CGAGCCCGACAAGGCCGAGGAGGACAAGGCCGAGCCTAGGAACGCTGAGGGGAAGGCCCGGGAGAAGGGCGGCGA
GGGAGATTCAACCAACAAGGAGGAGGCCACTGAGAACAAGGCGGAGGATGCGGAGGACGAGGCTGAGGCCAACAA
GGTCAAGACGGAGGCCGCCGAAGACAAGGCGGAGTCTGCCGAGTGCAAGGCGGTCAAGGTATCGTCTCCTGCAGT
GGTACGTTACCGCTCGACTCGGCGCGGCGTCCTCTGTGCAGTGATCTGACATGGTTTCTAGGACGTTCCCGCCGA
GGCTGTCGAGGCCGAGAACTGAAAAACAGAGATCGGTTGATGAGCGGTGCCTTGCTCTAATCAAACGGAGTTCGT
TACATCGATTGTTGATTTTCTTCTCGTTCTACGGCGTACGGTTCATGGTTCGATCGCGTCTGACTTCTGATTTCA
ATCTTCGCTTTCTCAGTGGCTATGACCCAGGCTCCATATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail