Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8585
Gene name
Locationscaffold_982:630..4233
Strand-
Gene length (bp)3603
Transcript length (bp)3543
Coding sequence length (bp)3540
Protein length (aa) 1180

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00806 PUF Pumilio-family RNA binding repeat 4.0E-05 690 722
PF00806 PUF Pumilio-family RNA binding repeat 8.0E-03 725 757
PF00806 PUF Pumilio-family RNA binding repeat 2.4E-02 768 785
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.2E-11 478 536

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60059|YG58_SCHPO Pumilio domain-containing protein C56F2.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC56F2.08c PE=1 SV=1 478 988 5.0E-128
sp|Q9P789|YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP35G2.14 PE=1 SV=2 474 970 8.0E-119
sp|P47135|JSN1_YEAST Protein JSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JSN1 PE=1 SV=1 599 983 2.0E-91
sp|Q12221|PUF2_YEAST mRNA-binding protein PUF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUF2 PE=1 SV=1 606 1002 2.0E-87
sp|Q92359|YDHE_SCHPO Pumilio domain-containing protein C6G9.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G9.14 PE=3 SV=1 675 961 2.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60059|YG58_SCHPO Pumilio domain-containing protein C56F2.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC56F2.08c PE=1 SV=1 478 988 5.0E-128
sp|Q9P789|YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP35G2.14 PE=1 SV=2 474 970 8.0E-119
sp|P47135|JSN1_YEAST Protein JSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JSN1 PE=1 SV=1 599 983 2.0E-91
sp|Q12221|PUF2_YEAST mRNA-binding protein PUF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUF2 PE=1 SV=1 606 1002 2.0E-87
sp|Q92359|YDHE_SCHPO Pumilio domain-containing protein C6G9.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G9.14 PE=3 SV=1 675 961 2.0E-26
sp|P25339|PUF4_YEAST Pumilio homology domain family member 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUF4 PE=1 SV=2 663 890 7.0E-21
sp|Q9LVC3|PUM12_ARATH Pumilio homolog 12 OS=Arabidopsis thaliana GN=APUM12 PE=2 SV=2 677 854 1.0E-18
sp|Q9LDW3|PUM11_ARATH Pumilio homolog 11 OS=Arabidopsis thaliana GN=APUM11 PE=3 SV=2 678 854 5.0E-17
sp|Q9ZW07|PUM1_ARATH Pumilio homolog 1 OS=Arabidopsis thaliana GN=APUM1 PE=1 SV=1 637 958 5.0E-17
sp|Q1PFN9|PUM9_ARATH Pumilio homolog 9 OS=Arabidopsis thaliana GN=APUM9 PE=2 SV=1 614 921 2.0E-16
sp|Q9ZW06|PUM2_ARATH Pumilio homolog 2 OS=Arabidopsis thaliana GN=APUM2 PE=1 SV=1 637 968 2.0E-15
sp|Q9LP21|PUM10_ARATH Putative pumilio homolog 10 OS=Arabidopsis thaliana GN=APUM10 PE=3 SV=2 678 951 2.0E-15
sp|Q9ZW02|PUM3_ARATH Pumilio homolog 3 OS=Arabidopsis thaliana GN=APUM3 PE=1 SV=1 637 958 3.0E-15
sp|Q9C9R6|PUM7_ARATH Putative pumilio homolog 7, chloroplastic OS=Arabidopsis thaliana GN=APUM7 PE=3 SV=2 678 916 1.0E-14
sp|P25822|PUM_DROME Maternal protein pumilio OS=Drosophila melanogaster GN=pum PE=1 SV=2 663 921 4.0E-14
sp|Q9LM20|PUM8_ARATH Putative pumilio homolog 8, chloroplastic OS=Arabidopsis thaliana GN=APUM8 PE=3 SV=2 678 915 5.0E-14
sp|Q9LJX4|PUM5_ARATH Pumilio homolog 5 OS=Arabidopsis thaliana GN=APUM5 PE=1 SV=2 663 933 1.0E-13
sp|Q9SS47|PUM4_ARATH Pumilio homolog 4 OS=Arabidopsis thaliana GN=APUM4 PE=1 SV=2 669 979 5.0E-13
sp|Q09829|YAD3_SCHPO Pumilio domain-containing protein C4G8.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.03c PE=3 SV=1 685 958 2.0E-12
sp|Q9C5E7|PUM6_ARATH Pumilio homolog 6, chloroplastic OS=Arabidopsis thaliana GN=APUM6 PE=1 SV=1 663 906 3.0E-12
sp|O94462|PUF3_SCHPO mRNA-binding protein puf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=puf3 PE=2 SV=4 675 906 4.0E-12
sp|E3WDQ9|PUM2_XENLA Pumilio homolog 2 OS=Xenopus laevis GN=pum2 PE=1 SV=1 663 897 7.0E-12
sp|Q80U58|PUM2_MOUSE Pumilio homolog 2 OS=Mus musculus GN=Pum2 PE=1 SV=2 663 892 1.0E-11
sp|Q8TB72|PUM2_HUMAN Pumilio homolog 2 OS=Homo sapiens GN=PUM2 PE=1 SV=2 680 897 2.0E-11
sp|Q80U58|PUM2_MOUSE Pumilio homolog 2 OS=Mus musculus GN=Pum2 PE=1 SV=2 632 897 3.0E-11
sp|Q8TB72|PUM2_HUMAN Pumilio homolog 2 OS=Homo sapiens GN=PUM2 PE=1 SV=2 632 897 4.0E-11
sp|Q5R5X3|PUM1_PONAB Pumilio homolog 1 OS=Pongo abelii GN=PUM1 PE=2 SV=1 680 892 2.0E-10
sp|Q66KI6|PUM1_XENLA Pumilio homolog 1 OS=Xenopus laevis GN=pum1 PE=1 SV=1 680 897 2.0E-10
sp|Q14671|PUM1_HUMAN Pumilio homolog 1 OS=Homo sapiens GN=PUM1 PE=1 SV=3 680 890 2.0E-10
sp|Q2VB19|PUM1_CHICK Pumilio homolog 1 OS=Gallus gallus GN=PUM1 PE=2 SV=1 680 890 3.0E-10
sp|Q80U78|PUM1_MOUSE Pumilio homolog 1 OS=Mus musculus GN=Pum1 PE=1 SV=2 663 865 3.0E-10
sp|Q2VB19|PUM1_CHICK Pumilio homolog 1 OS=Gallus gallus GN=PUM1 PE=2 SV=1 663 865 4.0E-10
sp|Q80U78|PUM1_MOUSE Pumilio homolog 1 OS=Mus musculus GN=Pum1 PE=1 SV=2 680 892 5.0E-10
sp|Q66KI6|PUM1_XENLA Pumilio homolog 1 OS=Xenopus laevis GN=pum1 PE=1 SV=1 663 865 6.0E-10
sp|Q9C5E7|PUM6_ARATH Pumilio homolog 6, chloroplastic OS=Arabidopsis thaliana GN=APUM6 PE=1 SV=1 682 866 1.0E-09
sp|Q14671|PUM1_HUMAN Pumilio homolog 1 OS=Homo sapiens GN=PUM1 PE=1 SV=3 685 865 3.0E-09
sp|Q5R5X3|PUM1_PONAB Pumilio homolog 1 OS=Pongo abelii GN=PUM1 PE=2 SV=1 685 865 4.0E-09
sp|P32831|NGR1_YEAST Negative growth regulatory protein NGR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NGR1 PE=1 SV=2 454 553 1.0E-06
sp|Q9LEB4|RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia GN=RBP45 PE=1 SV=1 476 556 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7094 0.378 0.2672 0.0874 0.1868 0.0269 0.1238 0.1351 0.0912 0.0262

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup474
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5945
Ophiocordyceps australis map64 (Brazil) OphauB2|7945
Ophiocordyceps camponoti-floridani Ophcf2|06480
Ophiocordyceps camponoti-rufipedis Ophun1|1610
Ophiocordyceps camponoti-rufipedis Ophun1|2376
Ophiocordyceps kimflemingae Ophio5|8585 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10454

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8585
MRWRLAILRAVPPPRPARNRLHQSPLPQPTPPPELITAASITTASWPPTRDPGLVLRRTKCPARAGYSRNGMSAS
LPSLALDGPNSTVSFLASDVVDRAREIQAQEGISTVPLNLWSGPPTSGNSTPLRENIPESPTDGFPDFAQLPTPE
SLPPTRRARAGTVPSRFSPGGPASGLLNVPSLAPKSARATPTQTPFNKSQSPSPSLEPPEGSSSGSALLSRLRAG
SMPQRSPYATLPTAGSPFGPSIFSSSWNPAGVGRERGSTLASIASVGSNGPSSPAQSHFSKDGGGGESDVHMRTL
DYLGLAETPQPPRAQLATPYMANFDYTKQSSRFRSYSVNNKDKYADDEDEYDVDAIHPDSQYVAAALQDQLAATN
VAIHNHNLAVQAFANQASVTRPRARTAGVLESPGGRLMRTYLTGNTAVPNPIPGTAEMRMPDDDEYDDLPQAIAS
MNLGRSSSRNAGMLGADEQGLEGPTSALWLGGMPTSTTTSTLVEMFKAHGPIVSARVLTHKNCGFVNFERVESAM
SARSSLNGKEIFPGAGPIRINFAKPPSSANTPGHDGAVPSPSPVPFPKSQEPGPGAAPAAGDGVQASAAGKTTPA
VPPLRDMTTDIVDIVGQFGASEDDKTTISRNVQSAIKYNGFIEEIAAIREPTQPRTHDAPRLRDIRKRIDNQLLS
QSDIEAVAMEMLSEIADLSSDYLGNTVVQKLFEHCRDPVRDAMLAKIGPHLAEIGIHKNGTWAAQKIIDVCKTPD
QMSVIVENLRPYTVPLFLDQYGNYVLQGCLKFGTPYNGFVFETMLSRMWEVAQGRFGARAMRACLESHHASKQQQ
RMLAAAIALHSVQLATNANGALLLTWFLDTCTFPQRRTVLSPRLVPCLVHLCTHKVAYLTVLKVINQKAEPDARD
TILKALFFTPNDQVLEAILNDHACGSTLIFKVLTTPFFDESIRGRVVENVKNVLVRIKAQPGQGYKRLMDEVGLS
TRAAGPNREGGNAHADQQRQRPASRHAGPNGHHAQQQGKAFFTPINPATGTAGFDVGYGPPRNDGADPSMSGFQP
YGQGVVFGSPAGPVAPAANLQQMQYQQSLMGRATPPMNYSFPPMQPGYGAYGGPGSAVDHFRQQNMPNGSPIQPP
SAQVPQMPGGQAPPPLGPPGFGLSMGNSYGYGGLAGMPNMGYMPQEQTSARRGRR
Coding >Ophio5|8585
ATGAGATGGCGCCTGGCTATTCTCCGCGCCGTTCCGCCCCCCAGACCCGCTCGCAATCGCCTTCATCAATCCCCC
CTCCCGCAACCGACGCCTCCGCCAGAGCTCATTACAGCGGCGTCAATCACAACGGCATCATGGCCGCCAACTCGC
GATCCGGGGCTGGTTCTCCGTCGCACGAAATGCCCGGCTCGGGCCGGCTATTCTCGAAACGGTATGTCCGCTTCC
CTTCCCTCGCTTGCTCTTGACGGCCCGAATTCGACCGTGTCTTTCCTCGCCTCTGACGTCGTCGATAGAGCCAGA
GAGATCCAGGCCCAAGAGGGCATATCTACCGTGCCCCTGAACCTGTGGAGCGGCCCTCCCACCAGCGGCAACTCG
ACACCCCTCCGCGAGAACATTCCCGAGTCGCCCACCGACGGCTTTCCCGACTTCGCCCAGCTGCCGACGCCCGAG
AGCCTACCTCCGACCAGAAGAGCCCGGGCCGGCACCGTCCCCTCCCGCTTCTCCCCCGGCGGCCCTGCCAGCGGT
CTGTTGAATGTTCCGAGCTTGGCGCCAAAGTCCGCCCGGGCCACCCCGACCCAGACGCCCTTTAACAAGTCTCAG
TCGCCTTCCCCCAGCCTCGAACCCCCCGAGGGCTCCTCGAGCGGCTCGGCCCTGCTGTCCCGCCTCCGAGCGGGC
TCCATGCCGCAGCGCAGCCCTTACGCCACGCTGCCCACCGCCGGCTCGCCCTTCGGCCCCTCCATCTTCAGCAGC
AGCTGGAACCCGGCTGGCGTCGGCCGCGAGCGAGGTTCCACCCTGGCCAGCATCGCCAGCGTCGGCTCCAATGGG
CCCAGTTCCCCGGCCCAGTCTCATTTCTCCAAGGACGGCGGCGGCGGGGAGTCCGACGTGCACATGCGGACGCTG
GATTACCTCGGCTTGGCAGAGACGCCGCAGCCGCCCCGGGCCCAGCTCGCCACGCCTTACATGGCCAACTTTGAC
TACACGAAGCAGTCCAGCCGCTTTCGCTCCTATTCCGTCAACAACAAGGACAAGTATGCCGATGACGAGGATGAA
TACGACGTTGACGCCATCCACCCGGACAGCCAGTACGTCGCCGCTGCCCTCCAAGACCAGCTGGCCGCCACAAAC
GTTGCCATTCACAACCACAACCTGGCCGTCCAGGCCTTCGCCAACCAAGCCTCGGTCACGCGCCCCCGGGCCCGC
ACCGCCGGTGTCTTGGAGTCGCCCGGCGGCCGCCTCATGAGGACCTATCTGACGGGCAACACGGCTGTCCCCAAC
CCCATCCCCGGCACCGCCGAGATGCGGATGCCGGACGACGACGAGTATGATGACCTCCCCCAAGCCATCGCCAGC
ATGAACCTCGGCAGGTCGAGCAGCCGCAACGCTGGCATGCTGGGCGCCGACGAGCAGGGGCTCGAGGGCCCCACG
AGCGCGCTCTGGTTGGGGGGCATGCCGACGTCGACCACCACGTCCACCCTGGTCGAAATGTTCAAGGCTCACGGC
CCCATCGTGTCGGCCCGGGTGCTGACGCACAAGAACTGCGGCTTCGTCAACTTTGAGAGGGTCGAGAGCGCCATG
TCGGCCAGGTCGAGCCTCAACGGCAAGGAGATCTTCCCCGGCGCCGGACCCATCCGCATCAACTTCGCCAAGCCT
CCCTCGTCGGCCAATACGCCCGGCCACGACGGGGCCGTCCCGTCCCCCAGCCCGGTCCCCTTCCCCAAGTCTCAG
GAGCCGGGCCCCGGCGCGGCTCCGGCGGCTGGAGATGGCGTGCAGGCCTCGGCCGCGGGCAAGACGACGCCCGCC
GTACCGCCCCTGCGTGACATGACGACGGACATTGTCGACATCGTCGGCCAGTTCGGGGCCTCCGAGGACGACAAG
ACGACCATCTCGCGCAACGTGCAGTCTGCCATCAAGTACAACGGCTTCATCGAGGAGATTGCCGCCATCCGAGAG
CCTACCCAACCACGGACTCACGACGCCCCGAGGCTGAGGGACATTCGCAAGCGCATCGACAACCAGCTTCTGTCC
CAGTCCGACATCGAGGCCGTGGCCATGGAGATGCTGTCGGAGATTGCGGATCTCTCGTCCGACTATCTGGGCAAC
ACGGTCGTCCAGAAGTTGTTTGAACACTGCCGCGACCCGGTGAGGGATGCCATGCTGGCCAAGATCGGGCCGCAC
CTGGCCGAGATAGGCATCCACAAGAACGGAACGTGGGCGGCGCAGAAGATCATTGACGTGTGCAAGACGCCCGAC
CAGATGTCCGTCATCGTCGAGAACCTCCGGCCGTACACGGTGCCCCTGTTCCTGGACCAGTACGGCAACTACGTG
CTGCAGGGCTGCCTCAAGTTCGGCACGCCATACAACGGGTTTGTCTTCGAGACGATGCTGAGCAGGATGTGGGAG
GTGGCACAGGGCCGCTTCGGCGCCCGCGCCATGCGGGCCTGTTTGGAGAGCCATCATGCGAGCAAGCAGCAGCAG
CGGATGCTGGCGGCCGCCATCGCCCTCCACAGCGTCCAGCTGGCGACCAACGCCAACGGCGCCCTCCTCCTGACC
TGGTTCCTCGACACGTGCACCTTTCCCCAGCGACGGACCGTCCTGTCCCCGCGGCTCGTCCCGTGCCTGGTTCAC
CTGTGCACCCACAAGGTGGCCTACCTGACGGTGCTCAAGGTCATTAACCAAAAGGCTGAGCCCGACGCGCGCGAC
ACCATACTAAAGGCCCTCTTCTTCACCCCCAACGACCAGGTGTTGGAGGCCATTCTCAACGACCACGCCTGCGGT
TCGACGCTCATCTTCAAGGTGCTGACGACGCCCTTTTTCGACGAGAGCATCCGGGGACGGGTGGTGGAGAACGTC
AAGAACGTGCTGGTCAGGATCAAGGCCCAGCCCGGACAGGGCTACAAGCGATTGATGGACGAGGTCGGCCTCTCG
ACCAGGGCGGCCGGGCCCAACCGCGAGGGAGGCAACGCCCACGCGGACCAGCAGCGACAACGGCCGGCCTCGAGG
CACGCCGGTCCCAACGGCCACCACGCGCAGCAGCAGGGCAAAGCCTTCTTCACTCCCATTAACCCCGCCACGGGC
ACCGCCGGCTTCGACGTCGGATACGGGCCTCCCAGGAATGACGGCGCCGACCCGAGCATGTCCGGCTTCCAGCCC
TACGGCCAGGGCGTCGTCTTCGGCTCGCCAGCCGGGCCCGTCGCCCCGGCGGCCAACCTGCAGCAGATGCAGTAC
CAGCAGAGCCTGATGGGCAGGGCGACGCCGCCCATGAACTACAGCTTTCCCCCGATGCAGCCCGGATACGGGGCC
TACGGCGGCCCGGGCTCGGCCGTGGACCATTTCCGGCAACAGAACATGCCCAACGGGAGCCCCATCCAGCCCCCG
TCGGCGCAGGTTCCCCAGATGCCAGGCGGCCAAGCGCCACCCCCGCTCGGGCCGCCGGGTTTCGGGCTCTCGATG
GGCAACTCGTACGGATACGGCGGCCTGGCGGGCATGCCGAATATGGGATACATGCCGCAAGAACAGACGAGCGCA
CGACGCGGCCGCAGA
Transcript >Ophio5|8585
ATGAGATGGCGCCTGGCTATTCTCCGCGCCGTTCCGCCCCCCAGACCCGCTCGCAATCGCCTTCATCAATCCCCC
CTCCCGCAACCGACGCCTCCGCCAGAGCTCATTACAGCGGCGTCAATCACAACGGCATCATGGCCGCCAACTCGC
GATCCGGGGCTGGTTCTCCGTCGCACGAAATGCCCGGCTCGGGCCGGCTATTCTCGAAACGGTATGTCCGCTTCC
CTTCCCTCGCTTGCTCTTGACGGCCCGAATTCGACCGTGTCTTTCCTCGCCTCTGACGTCGTCGATAGAGCCAGA
GAGATCCAGGCCCAAGAGGGCATATCTACCGTGCCCCTGAACCTGTGGAGCGGCCCTCCCACCAGCGGCAACTCG
ACACCCCTCCGCGAGAACATTCCCGAGTCGCCCACCGACGGCTTTCCCGACTTCGCCCAGCTGCCGACGCCCGAG
AGCCTACCTCCGACCAGAAGAGCCCGGGCCGGCACCGTCCCCTCCCGCTTCTCCCCCGGCGGCCCTGCCAGCGGT
CTGTTGAATGTTCCGAGCTTGGCGCCAAAGTCCGCCCGGGCCACCCCGACCCAGACGCCCTTTAACAAGTCTCAG
TCGCCTTCCCCCAGCCTCGAACCCCCCGAGGGCTCCTCGAGCGGCTCGGCCCTGCTGTCCCGCCTCCGAGCGGGC
TCCATGCCGCAGCGCAGCCCTTACGCCACGCTGCCCACCGCCGGCTCGCCCTTCGGCCCCTCCATCTTCAGCAGC
AGCTGGAACCCGGCTGGCGTCGGCCGCGAGCGAGGTTCCACCCTGGCCAGCATCGCCAGCGTCGGCTCCAATGGG
CCCAGTTCCCCGGCCCAGTCTCATTTCTCCAAGGACGGCGGCGGCGGGGAGTCCGACGTGCACATGCGGACGCTG
GATTACCTCGGCTTGGCAGAGACGCCGCAGCCGCCCCGGGCCCAGCTCGCCACGCCTTACATGGCCAACTTTGAC
TACACGAAGCAGTCCAGCCGCTTTCGCTCCTATTCCGTCAACAACAAGGACAAGTATGCCGATGACGAGGATGAA
TACGACGTTGACGCCATCCACCCGGACAGCCAGTACGTCGCCGCTGCCCTCCAAGACCAGCTGGCCGCCACAAAC
GTTGCCATTCACAACCACAACCTGGCCGTCCAGGCCTTCGCCAACCAAGCCTCGGTCACGCGCCCCCGGGCCCGC
ACCGCCGGTGTCTTGGAGTCGCCCGGCGGCCGCCTCATGAGGACCTATCTGACGGGCAACACGGCTGTCCCCAAC
CCCATCCCCGGCACCGCCGAGATGCGGATGCCGGACGACGACGAGTATGATGACCTCCCCCAAGCCATCGCCAGC
ATGAACCTCGGCAGGTCGAGCAGCCGCAACGCTGGCATGCTGGGCGCCGACGAGCAGGGGCTCGAGGGCCCCACG
AGCGCGCTCTGGTTGGGGGGCATGCCGACGTCGACCACCACGTCCACCCTGGTCGAAATGTTCAAGGCTCACGGC
CCCATCGTGTCGGCCCGGGTGCTGACGCACAAGAACTGCGGCTTCGTCAACTTTGAGAGGGTCGAGAGCGCCATG
TCGGCCAGGTCGAGCCTCAACGGCAAGGAGATCTTCCCCGGCGCCGGACCCATCCGCATCAACTTCGCCAAGCCT
CCCTCGTCGGCCAATACGCCCGGCCACGACGGGGCCGTCCCGTCCCCCAGCCCGGTCCCCTTCCCCAAGTCTCAG
GAGCCGGGCCCCGGCGCGGCTCCGGCGGCTGGAGATGGCGTGCAGGCCTCGGCCGCGGGCAAGACGACGCCCGCC
GTACCGCCCCTGCGTGACATGACGACGGACATTGTCGACATCGTCGGCCAGTTCGGGGCCTCCGAGGACGACAAG
ACGACCATCTCGCGCAACGTGCAGTCTGCCATCAAGTACAACGGCTTCATCGAGGAGATTGCCGCCATCCGAGAG
CCTACCCAACCACGGACTCACGACGCCCCGAGGCTGAGGGACATTCGCAAGCGCATCGACAACCAGCTTCTGTCC
CAGTCCGACATCGAGGCCGTGGCCATGGAGATGCTGTCGGAGATTGCGGATCTCTCGTCCGACTATCTGGGCAAC
ACGGTCGTCCAGAAGTTGTTTGAACACTGCCGCGACCCGGTGAGGGATGCCATGCTGGCCAAGATCGGGCCGCAC
CTGGCCGAGATAGGCATCCACAAGAACGGAACGTGGGCGGCGCAGAAGATCATTGACGTGTGCAAGACGCCCGAC
CAGATGTCCGTCATCGTCGAGAACCTCCGGCCGTACACGGTGCCCCTGTTCCTGGACCAGTACGGCAACTACGTG
CTGCAGGGCTGCCTCAAGTTCGGCACGCCATACAACGGGTTTGTCTTCGAGACGATGCTGAGCAGGATGTGGGAG
GTGGCACAGGGCCGCTTCGGCGCCCGCGCCATGCGGGCCTGTTTGGAGAGCCATCATGCGAGCAAGCAGCAGCAG
CGGATGCTGGCGGCCGCCATCGCCCTCCACAGCGTCCAGCTGGCGACCAACGCCAACGGCGCCCTCCTCCTGACC
TGGTTCCTCGACACGTGCACCTTTCCCCAGCGACGGACCGTCCTGTCCCCGCGGCTCGTCCCGTGCCTGGTTCAC
CTGTGCACCCACAAGGTGGCCTACCTGACGGTGCTCAAGGTCATTAACCAAAAGGCTGAGCCCGACGCGCGCGAC
ACCATACTAAAGGCCCTCTTCTTCACCCCCAACGACCAGGTGTTGGAGGCCATTCTCAACGACCACGCCTGCGGT
TCGACGCTCATCTTCAAGGTGCTGACGACGCCCTTTTTCGACGAGAGCATCCGGGGACGGGTGGTGGAGAACGTC
AAGAACGTGCTGGTCAGGATCAAGGCCCAGCCCGGACAGGGCTACAAGCGATTGATGGACGAGGTCGGCCTCTCG
ACCAGGGCGGCCGGGCCCAACCGCGAGGGAGGCAACGCCCACGCGGACCAGCAGCGACAACGGCCGGCCTCGAGG
CACGCCGGTCCCAACGGCCACCACGCGCAGCAGCAGGGCAAAGCCTTCTTCACTCCCATTAACCCCGCCACGGGC
ACCGCCGGCTTCGACGTCGGATACGGGCCTCCCAGGAATGACGGCGCCGACCCGAGCATGTCCGGCTTCCAGCCC
TACGGCCAGGGCGTCGTCTTCGGCTCGCCAGCCGGGCCCGTCGCCCCGGCGGCCAACCTGCAGCAGATGCAGTAC
CAGCAGAGCCTGATGGGCAGGGCGACGCCGCCCATGAACTACAGCTTTCCCCCGATGCAGCCCGGATACGGGGCC
TACGGCGGCCCGGGCTCGGCCGTGGACCATTTCCGGCAACAGAACATGCCCAACGGGAGCCCCATCCAGCCCCCG
TCGGCGCAGGTTCCCCAGATGCCAGGCGGCCAAGCGCCACCCCCGCTCGGGCCGCCGGGTTTCGGGCTCTCGATG
GGCAACTCGTACGGATACGGCGGCCTGGCGGGCATGCCGAATATGGGATACATGCCGCAAGAACAGACGAGCGCA
CGACGCGGCCGCAGATGA
Gene >Ophio5|8585
ATGAGATGGCGCCTGGCTATTCTCCGCGCCGTTCCGCCCCCCAGACCCGCTCGCAATCGCCTTCATCAATCCCCC
CTCCCGCAACCGACGCCTCCGCCAGAGCTCATTACAGCGGCGTCAATCACAACGGCATCATGGCCGCCAACTCGC
GATCCGGGGCTGGTTCTCCGTCGCACGAAATGCCCGGCTCGGGCCGGCTATTCTCGAAACGGTATGTCCGCTTCC
CTTCCCTCGCTTGCTCTTGACGGCCCGAATTCGACCGTGTCTTTCCTCGCCTCTGACGTCGTCGATAGAGCCAGA
GAGATCCAGGCCCAAGAGGGCATATCTACCGTGCCCCTGAACCTGTGGAGCGGCCCTCCCACCAGCGGCAACTCG
ACACCCCTCCGCGAGAACATTCCCGAGTCGCCCACCGACGGCTTTCCCGACTTCGCCCAGCTGCCGACGCCCGAG
AGCCTACCTCCGACCAGAAGAGCCCGGGCCGGCACCGTCCCCTCCCGCTTCTCCCCCGGCGGCCCTGCCAGCGGT
CTGTTGAATGTTCCGAGCTTGGCGCCAAAGTCCGCCCGGGCCACCCCGACCCAGACGCCCTTTAACAAGTCTCAG
TCGCCTTCCCCCAGCCTCGAACCCCCCGAGGGCTCCTCGAGCGGCTCGGCCCTGCTGTCCCGCCTCCGAGCGGGC
TCCATGCCGCAGCGCAGCCCTTACGCCACGCTGCCCACCGCCGGCTCGCCCTTCGGCCCCTCCATCTTCAGCAGC
AGCTGGAACCCGGCTGGCGTCGGCCGCGAGCGAGGTTCCACCCTGGCCAGCATCGCCAGCGTCGGCTCCAATGGG
CCCAGTTCCCCGGCCCAGTCTCATTTCTCCAAGGACGGCGGCGGCGGGGAGTCCGACGTGCACATGCGGACGCTG
GATTACCTCGGCTTGGCAGAGACGCCGCAGCCGCCCCGGGCCCAGCTCGCCACGCCTTACATGGCCAACTTTGAC
TACACGAAGCAGTCCAGCCGCTTTCGCTCCTATTCCGTCAACAACAAGGACAAGTATGCCGATGACGAGGATGAA
TACGACGTTGACGCCATCCACCCGGACAGCCAGTACGTCGCCGCTGCCCTCCAAGACCAGCTGGCCGCCACAAAC
GTTGCCATTCACAACCACAACCTGGCCGTCCAGGCCTTCGCCAACCAAGCCTCGGTCACGCGCCCCCGGGCCCGC
ACCGCCGGTGTCTTGGAGTCGCCCGGCGGCCGCCTCATGAGGACCTATCTGACGGGCAACACGGCTGTCCCCAAC
CCCATCCCCGGCACCGCCGAGATGCGGATGCCGGACGACGACGAGTATGATGACCTCCCCCAAGCCATCGCCAGC
ATGAACCTCGGCAGGTCGAGCAGCCGCAACGCTGGCATGCTGGGCGCCGACGAGCAGGGGCTCGAGGGCCCCACG
AGCGCGCTCTGGTTGGGGGGCATGCCGACGTCGACCACCACGTCCACCCTGGTCGAAATGTTCAAGGCTCACGGC
CCCATCGTGTCGGCCCGGGTGCTGACGCACAAGAACTGCGGCTTCGTCAACTTTGAGAGGGTCGAGAGCGCCATG
TCGGCCAGGTCGAGCCTCAACGGCAAGGAGATCTTCCCCGGCGCCGGACCCATCCGCATCAACTTCGCCAAGCCT
CCCTCGTCGGCCAATACGCCCGGCCACGACGGGGCCGTCCCGTCCCCCAGCCCGGTCCCCTTCCCCAAGTCTCAG
GAGCCGGGCCCCGGCGCGGCTCCGGCGGCTGGAGATGGCGTGCAGGCCTCGGCCGCGGGCAAGACGACGCCCGCC
GTACCGCCCCTGCGTGACATGACGACGGACATTGTCGACATCGTCGGCCAGTTCGGGGCCTCCGAGGACGACAAG
ACGACCATCTCGCGCAACGTGCAGTCTGCCATCAAGTACAACGGCTTCATCGAGGAGATTGCCGCCATCCGAGAG
CCTACCCAACCACGGACTCACGACGCCCCGAGGCTGAGGGACATTCGCAAGCGCATCGACAACCAGCTTCTGTCC
CAGTCCGACATCGAGGCCGTGGCCATGGAGATGCTGTCGGAGATTGCGGATCTCTCGTCCGACTATCTGGGCAAC
ACGGTCGTCCAGAAGTTGTTTGAACACTGCCGCGACCCGGTGAGGGATGCCATGCTGGCCAAGATCGGGCCGCAC
CTGGCCGAGATAGGCATCCACAAGAACGGAACGTGGGCGGCGCAGAAGATCATTGACGTGTGCAAGACGCCCGAC
CAGATGTCCGTCATCGTCGAGAACCTCCGGCCGTACACGGTGCCCCTGTTCCTGGACCAGTACGGCAACTACGTG
CTGCAGGGCTGCCTCAAGTTCGGCACGCCATACAACGGGTTTGTCTTCGAGACGATGCTGAGCAGGATGTGGGAG
GTGGCACAGGGCCGCTTCGGCGCCCGCGCCATGCGGGCCTGTTTGGAGAGCCATCATGCGAGCAAGCAGCAGCAG
CGGATGCTGGCGGCCGCCATCGCCCTCCACAGCGTCCAGCTGGCGACCAACGCCAACGGCGCCCTCCTCCTGACC
TGGTTCCTCGACACGTGCACCTTTCCCCAGCGACGGACCGTCCTGTCCCCGCGGCTCGTCCCGTGCCTGGTTCAC
CTGTGCACCCACAAGGTGGCCTACCTGACGGTGCTCAAGGTCATTAACCAAAAGGCTGAGCCCGACGCGCGCGAC
ACCATACTAAAGGCCCTCTTCTTCACCCCCAACGACCAGGTGTTGGAGGCCATTCTCAACGACCACGCCTGCGGT
TCGACGCTCATCTTCAAGGTGCTGACGACGCCCTTTTTCGACGAGAGCATCCGGGGACGGGTGGTGGAGAACGTC
AAGAACGTGCTGGTCAGGATCAAGGCCCAGCCCGGACAGGGCTACAAGCGATTGATGGACGAGGTCGGCCTCTCG
ACCAGGGCGGCCGGGCCCAACCGCGAGGGAGGCAACGCCCACGCGGACCAGCAGCGACAACGGCCGGCCTCGAGG
CACGCCGGTCCCAACGGCCACCACGCGCAGCAGCAGGGCAAAGCCTTCTTCACTCCCATTAACCCCGCCACGGGC
ACCGCCGGCTTCGACGTCGGATACGGGCCTCCCAGGAATGACGGCGCCGACCCGAGCATGTCCGGCTTCCAGCCC
TACGGCCAGGGCGTCGTCTTCGGCTCGCCAGCCGGGCCCGTCGCCCCGGCGGCCAACCTGCAGCAGATGCAGTAC
CAGCAGAGCCTGATGGGCAGGGCGACGCCGCCCATGAACTACAGCTTTCCCCCGATGCAGCCCGGATACGGGGCC
TACGGCGGCCCGGGCTCGGCCGTGGACCATTTCCGGCAACAGAACATGCCCAACGGGAGCCCCATCCAGCCCCCG
TCGGCGCAGGTTCCCCAGATGCCAGGCGGCCAAGCGCCACCCCCGCTCGGGCCGCCGGGTTTCGGGCTCTCGATG
GGCAACTCGTACGGATACGGCGGCCTGGCGGGCATGCCGAATATGGGATACATGCCGCAAGAACAGACGAGCGCA
CGACGCGGCCGCGTATGTCTCGTCGCTGGCCAGTCGCCCTTGATGGGATGAGGAAGCTGACAGTCGTAACAGAGA
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail