Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8582
Gene name
Locationscaffold_98:42065..43056
Strand+
Gene length (bp)991
Transcript length (bp)879
Coding sequence length (bp)876
Protein length (aa) 292

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01965 DJ-1_PfpI DJ-1/PfpI family 3.9E-14 17 178

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.7706 0.3585 0.1117 0.1651 0.1806 0.0283 0.0863 0.0547 0.1409 0.0031

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3538
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|127
Ophiocordyceps australis map64 (Brazil) OphauB2|4211
Ophiocordyceps camponoti-floridani Ophcf2|04007
Ophiocordyceps camponoti-rufipedis Ophun1|5716
Ophiocordyceps kimflemingae Ophio5|8582 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6785

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8582
MAANKSSAVADQEPIDVLIAVQHKFDLLDFAGPVEAITRAAHDFKDETTKAFEVTIVGAEPKVLSDQGVIIGSQM
SFKEAHERLEEFDVLIIVGGNTQEILDKEMEPLGLIKDFAELQKKDPARERTVLSICTGSLLLAREGILSGLSAT
THPDYLTRFENVCSDAATRNMTERTDVIEDARYVVNNLRFDLGDEDENPYIRRQSDAGRRSSSARKGSMSWKGSN
SRRESMARRAAMRLGGLRVITAGGVSSGVDAALYLISAMVDDACAIEVARILQWTWTKGIVVDGLDV
Coding >Ophio5|8582
ATGGCTGCAAACAAGTCTTCCGCTGTTGCGGACCAAGAACCCATTGACGTCCTCATCGCAGTGCAACACAAGTTC
GACTTGCTCGACTTTGCTGGGCCCGTCGAGGCCATCACCCGCGCTGCTCACGACTTCAAGGACGAGACCACCAAG
GCCTTCGAGGTGACCATTGTGGGGGCCGAGCCCAAGGTCCTCAGCGACCAGGGCGTCATCATCGGCTCCCAGATG
TCATTCAAGGAAGCACACGAGCGCCTCGAAGAATTCGACGTCCTCATAATTGTTGGTGGCAACACGCAAGAGATC
CTCGACAAGGAAATGGAGCCGCTCGGCCTCATCAAGGACTTCGCCGAGCTCCAGAAGAAAGATCCGGCCCGCGAA
CGGACCGTCTTGTCCATCTGCACCGGCTCGCTCCTACTCGCCAGAGAAGGCATTCTCTCGGGCCTCTCAGCAACG
ACACATCCCGATTACCTCACCAGGTTTGAGAACGTATGCAGTGATGCCGCCACACGCAACATGACGGAGCGCACC
GACGTCATCGAGGATGCCAGATACGTCGTCAACAATCTCCGCTTCGACCTCGGAGACGAGGACGAGAACCCATAT
ATCCGCCGGCAGTCCGACGCAGGACGCCGGTCATCTTCCGCTCGCAAGGGTAGCATGTCCTGGAAGGGATCCAAT
TCACGTCGCGAATCCATGGCCCGCCGTGCCGCCATGCGTCTTGGGGGGCTCAGGGTCATCACGGCCGGGGGAGTG
AGCTCGGGCGTCGACGCGGCCCTCTATCTGATTAGTGCCATGGTGGACGACGCGTGTGCCATCGAAGTTGCCAGG
ATTTTGCAGTGGACGTGGACCAAGGGCATCGTCGTCGACGGTCTCGACGTC
Transcript >Ophio5|8582
ATGGCTGCAAACAAGTCTTCCGCTGTTGCGGACCAAGAACCCATTGACGTCCTCATCGCAGTGCAACACAAGTTC
GACTTGCTCGACTTTGCTGGGCCCGTCGAGGCCATCACCCGCGCTGCTCACGACTTCAAGGACGAGACCACCAAG
GCCTTCGAGGTGACCATTGTGGGGGCCGAGCCCAAGGTCCTCAGCGACCAGGGCGTCATCATCGGCTCCCAGATG
TCATTCAAGGAAGCACACGAGCGCCTCGAAGAATTCGACGTCCTCATAATTGTTGGTGGCAACACGCAAGAGATC
CTCGACAAGGAAATGGAGCCGCTCGGCCTCATCAAGGACTTCGCCGAGCTCCAGAAGAAAGATCCGGCCCGCGAA
CGGACCGTCTTGTCCATCTGCACCGGCTCGCTCCTACTCGCCAGAGAAGGCATTCTCTCGGGCCTCTCAGCAACG
ACACATCCCGATTACCTCACCAGGTTTGAGAACGTATGCAGTGATGCCGCCACACGCAACATGACGGAGCGCACC
GACGTCATCGAGGATGCCAGATACGTCGTCAACAATCTCCGCTTCGACCTCGGAGACGAGGACGAGAACCCATAT
ATCCGCCGGCAGTCCGACGCAGGACGCCGGTCATCTTCCGCTCGCAAGGGTAGCATGTCCTGGAAGGGATCCAAT
TCACGTCGCGAATCCATGGCCCGCCGTGCCGCCATGCGTCTTGGGGGGCTCAGGGTCATCACGGCCGGGGGAGTG
AGCTCGGGCGTCGACGCGGCCCTCTATCTGATTAGTGCCATGGTGGACGACGCGTGTGCCATCGAAGTTGCCAGG
ATTTTGCAGTGGACGTGGACCAAGGGCATCGTCGTCGACGGTCTCGACGTCTAA
Gene >Ophio5|8582
ATGGCTGCAAACAAGTCTTCCGCTGTTGCGGACCAAGAACCCATTGACGTCCTCATCGCAGTGCAACACAAGTTC
GACTTGCTCGACTTTGCTGGGCCCGTCGAGGCCATCACCCGCGCTGCTCACGACTTCAAGGACGAGAGTACGCAG
GTCGCTCCCCACTTTCCATGTCTTTCCTACTGACCTTTGCACGTCACAGCCACCAAGGCCTTCGAGGTGACCATT
GTGGGGGCCGAGCCCAAGGTCCTCAGCGACCAGGGCGTCATCATCGGCTCCCAGATGTCATTCAAGGAAGCACAC
GAGCGCCTCGAAGAATTCGACGTCCTCATAATTGTTGGTGGCAACACGCAAGAGATCCTCGACAAGGAAATGGAG
CCGCTCGGCCTCATCAAGGACTTCGCCGAGCTCCAGAAGAAAGATCCGGCCCGCGAACGGACCGTCTTGTCCATC
TGCACCGGCTCGCTCCTACTCGCCAGAGAAGGCATTCTCTCGGGCCTCTCAGCAACGACACATCCCGATTACCTC
ACCAGGTTTGAGAACGTATGCAGTGATGCCGCCACACGCAACATGACGGAGCGCACCGACGTCATCGAGGATGCC
AGATACGTCGTCAACAATCTCCGCTTCGACCTCGGAGACGAGGACGAGAACCCATATATCCGCCGGCAGTCCGAC
GCAGGACGCCGGTCATCTTCCGCTCGGTGAGTTTTGTGTTTCTGGGCCACTCGACAGCCGCTGACGTGTGGGGGC
CTACAGCAAGGGTAGCATGTCCTGGAAGGGATCCAATTCACGTCGCGAATCCATGGCCCGCCGTGCCGCCATGCG
TCTTGGGGGGCTCAGGGTCATCACGGCCGGGGGAGTGAGCTCGGGCGTCGACGCGGCCCTCTATCTGATTAGTGC
CATGGTGGACGACGCGTGTGCCATCGAAGTTGCCAGGATTTTGCAGTGGACGTGGACCAAGGGCATCGTCGTCGA
CGGTCTCGACGTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail