Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8580
Gene name
Locationscaffold_98:34129..35890
Strand-
Gene length (bp)1761
Transcript length (bp)1689
Coding sequence length (bp)1686
Protein length (aa) 562

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17 5.9E-08 164 276

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2UUZ1|EGLC_ASPOR Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=eglC PE=3 SV=1 7 321 9.0E-98
sp|Q4WG16|EGLC_ASPFU Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eglC PE=3 SV=1 23 316 2.0E-94
sp|B0XXF8|EGLC_ASPFC Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=eglC PE=3 SV=1 23 316 2.0E-94
sp|Q5AUT0|EGLC_EMENI Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglC PE=1 SV=1 3 316 1.0E-93
sp|A1CD22|EGLC_ASPCL Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=eglC PE=3 SV=1 23 316 2.0E-93
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2UUZ1|EGLC_ASPOR Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=eglC PE=3 SV=1 7 321 9.0E-98
sp|Q4WG16|EGLC_ASPFU Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eglC PE=3 SV=1 23 316 2.0E-94
sp|B0XXF8|EGLC_ASPFC Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=eglC PE=3 SV=1 23 316 2.0E-94
sp|Q5AUT0|EGLC_EMENI Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglC PE=1 SV=1 3 316 1.0E-93
sp|A1CD22|EGLC_ASPCL Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=eglC PE=3 SV=1 23 316 2.0E-93
sp|A1DJ47|EGLC_NEOFI Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=eglC PE=3 SV=1 23 316 2.0E-92
sp|Q0C7P6|EGLC_ASPTN Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=eglC PE=3 SV=1 20 327 6.0E-92
sp|A2QH21|EGLC_ASPNC Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=eglC PE=3 SV=2 6 318 5.0E-88
sp|D4B2W4|BGL2_ARTBC Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02797 PE=1 SV=1 1 276 2.0E-14
sp|O13990|BGL2_SCHPO Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgl2 PE=2 SV=4 88 303 2.0E-11
sp|P15703|BGL2_YEAST Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BGL2 PE=1 SV=1 36 276 1.0E-09
sp|Q5AMT2|BGL2_CANAL Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BGL2 PE=1 SV=1 80 276 1.0E-08
sp|P43070|BGL2_CANAX Glucan 1,3-beta-glucosidase OS=Candida albicans GN=BGL2 PE=3 SV=1 80 276 4.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8580
MPFSTAQLVTLAAAVSSASATFRGFNYGALKGSVPKTQTDFENEFTAASALPGTDGKFSSARLYTMIQGGTPNEP
ISAIPAAIKCKTSLLLGLWASAGEASFANEIEALRKTTKQYCKQLDGLVAGISVGSEDLYRETPTGKQNKEYAGT
SPKTLVNYIRQTREAVKGTCLEKAPIGHVDTWTAYANSSNEAVFPELDWLGVDEYPYYEYQKPNAIEEADKLFHA
AIDEVQKVINKGGKNQEIWITEMGWPVEGKTTGQAVASKKNAEYYWKKVACPTFIKRNVWYYTLQDGDAQNKPNP
SFGLVNDLKGKPLIDLSCSGSQASNKSESDETDDSGSGSGGKDKSASGNGSGETDKSGSGKESEYESGSKCTSGQ
CSGSDKNSGSGSDYGSSSGNGSGKCASGQCSGSGEGQGSDNYGSGSGSGKGSDNYGSGSESGSGKGSGSDSYGSG
SSSGKDSDSGSSKGSDNYGSGSESGSGKSSGPGSETSSGSGCGSGQCSGSNPAPAVSTLRSYPSGASNSSANGNA
PGYGNQLSPTTVAQAAGSHLSSLGAAAVALVLAVAAL
Coding >Ophio5|8580
ATGCCATTCTCTACCGCCCAGCTCGTCACTCTCGCCGCGGCCGTGTCGTCGGCCTCGGCTACTTTCAGGGGTTTC
AACTATGGCGCTTTGAAGGGCTCGGTGCCCAAGACGCAAACCGATTTTGAGAACGAGTTCACGGCTGCCTCGGCT
CTACCGGGCACCGATGGCAAGTTCAGCAGTGCCCGTCTCTACACCATGATCCAAGGAGGCACTCCCAACGAACCC
ATCTCCGCCATCCCAGCCGCCATCAAGTGCAAGACCAGCCTTCTGTTGGGTCTTTGGGCCTCAGCCGGCGAAGCC
TCCTTCGCCAACGAGATCGAGGCGCTCCGGAAGACAACCAAGCAGTACTGCAAGCAGCTCGACGGCCTGGTGGCC
GGCATTTCCGTCGGCAGCGAGGATCTGTACCGTGAGACGCCGACGGGTAAGCAAAATAAGGAGTACGCGGGCACG
AGCCCCAAGACTCTCGTCAACTACATCCGGCAAACCAGGGAGGCCGTCAAGGGCACCTGTCTCGAAAAGGCACCG
ATCGGTCACGTCGACACCTGGACGGCCTACGCCAACTCGTCCAACGAGGCCGTCTTCCCCGAACTCGACTGGCTC
GGTGTGGATGAATACCCCTACTACGAATATCAGAAGCCCAATGCGATCGAGGAGGCCGATAAGCTCTTCCACGCT
GCCATCGACGAGGTCCAGAAGGTCATCAACAAGGGCGGCAAGAATCAGGAGATTTGGATCACCGAGATGGGCTGG
CCCGTCGAGGGAAAGACGACCGGTCAGGCTGTCGCGTCCAAGAAGAATGCCGAGTATTACTGGAAGAAGGTGGCC
TGCCCTACCTTTATCAAGAGGAACGTCTGGTACTACACTCTTCAGGATGGCGATGCCCAGAACAAGCCCAACCCT
AGCTTCGGTCTGGTCAACGACCTCAAGGGCAAGCCCCTGATTGACCTCTCCTGCAGTGGCTCGCAAGCGTCCAAC
AAGTCCGAGTCGGATGAGACTGATGATTCCGGCAGCGGCTCTGGTGGCAAGGACAAATCGGCTTCCGGTAACGGC
TCCGGCGAAACGGACAAGTCTGGCTCTGGAAAGGAGTCCGAGTACGAGTCTGGTTCGAAGTGTACCTCTGGTCAA
TGCTCTGGGTCGGACAAGAACTCTGGCTCGGGGTCCGACTACGGCTCCAGCTCGGGCAATGGCTCTGGCAAGTGT
GCTTCGGGTCAATGCTCCGGCTCCGGGGAGGGTCAGGGCTCCGACAACTACGGCTCCGGCTCTGGATCTGGTAAG
GGCTCCGATAACTACGGCTCCGGCTCTGAATCAGGCTCCGGCAAGGGCTCCGGCTCCGACAGCTACGGCTCTGGT
TCCAGCTCTGGCAAGGACTCCGACTCCGGCTCTAGCAAGGGCTCCGACAACTACGGCTCCGGCTCTGAATCGGGC
TCCGGCAAGAGCTCCGGCCCTGGATCCGAGACCAGCTCCGGCTCCGGATGTGGCTCCGGCCAATGCTCCGGCTCG
AACCCCGCCCCCGCCGTGAGCACCCTGAGGTCCTATCCCTCCGGTGCGTCCAACTCCAGCGCCAACGGCAACGCT
CCCGGCTACGGCAACCAGCTCAGCCCCACGACCGTTGCCCAGGCCGCCGGCAGCCACCTCAGCTCTCTGGGGGCT
GCTGCCGTGGCCCTCGTCCTGGCCGTGGCGGCTCTG
Transcript >Ophio5|8580
ATGCCATTCTCTACCGCCCAGCTCGTCACTCTCGCCGCGGCCGTGTCGTCGGCCTCGGCTACTTTCAGGGGTTTC
AACTATGGCGCTTTGAAGGGCTCGGTGCCCAAGACGCAAACCGATTTTGAGAACGAGTTCACGGCTGCCTCGGCT
CTACCGGGCACCGATGGCAAGTTCAGCAGTGCCCGTCTCTACACCATGATCCAAGGAGGCACTCCCAACGAACCC
ATCTCCGCCATCCCAGCCGCCATCAAGTGCAAGACCAGCCTTCTGTTGGGTCTTTGGGCCTCAGCCGGCGAAGCC
TCCTTCGCCAACGAGATCGAGGCGCTCCGGAAGACAACCAAGCAGTACTGCAAGCAGCTCGACGGCCTGGTGGCC
GGCATTTCCGTCGGCAGCGAGGATCTGTACCGTGAGACGCCGACGGGTAAGCAAAATAAGGAGTACGCGGGCACG
AGCCCCAAGACTCTCGTCAACTACATCCGGCAAACCAGGGAGGCCGTCAAGGGCACCTGTCTCGAAAAGGCACCG
ATCGGTCACGTCGACACCTGGACGGCCTACGCCAACTCGTCCAACGAGGCCGTCTTCCCCGAACTCGACTGGCTC
GGTGTGGATGAATACCCCTACTACGAATATCAGAAGCCCAATGCGATCGAGGAGGCCGATAAGCTCTTCCACGCT
GCCATCGACGAGGTCCAGAAGGTCATCAACAAGGGCGGCAAGAATCAGGAGATTTGGATCACCGAGATGGGCTGG
CCCGTCGAGGGAAAGACGACCGGTCAGGCTGTCGCGTCCAAGAAGAATGCCGAGTATTACTGGAAGAAGGTGGCC
TGCCCTACCTTTATCAAGAGGAACGTCTGGTACTACACTCTTCAGGATGGCGATGCCCAGAACAAGCCCAACCCT
AGCTTCGGTCTGGTCAACGACCTCAAGGGCAAGCCCCTGATTGACCTCTCCTGCAGTGGCTCGCAAGCGTCCAAC
AAGTCCGAGTCGGATGAGACTGATGATTCCGGCAGCGGCTCTGGTGGCAAGGACAAATCGGCTTCCGGTAACGGC
TCCGGCGAAACGGACAAGTCTGGCTCTGGAAAGGAGTCCGAGTACGAGTCTGGTTCGAAGTGTACCTCTGGTCAA
TGCTCTGGGTCGGACAAGAACTCTGGCTCGGGGTCCGACTACGGCTCCAGCTCGGGCAATGGCTCTGGCAAGTGT
GCTTCGGGTCAATGCTCCGGCTCCGGGGAGGGTCAGGGCTCCGACAACTACGGCTCCGGCTCTGGATCTGGTAAG
GGCTCCGATAACTACGGCTCCGGCTCTGAATCAGGCTCCGGCAAGGGCTCCGGCTCCGACAGCTACGGCTCTGGT
TCCAGCTCTGGCAAGGACTCCGACTCCGGCTCTAGCAAGGGCTCCGACAACTACGGCTCCGGCTCTGAATCGGGC
TCCGGCAAGAGCTCCGGCCCTGGATCCGAGACCAGCTCCGGCTCCGGATGTGGCTCCGGCCAATGCTCCGGCTCG
AACCCCGCCCCCGCCGTGAGCACCCTGAGGTCCTATCCCTCCGGTGCGTCCAACTCCAGCGCCAACGGCAACGCT
CCCGGCTACGGCAACCAGCTCAGCCCCACGACCGTTGCCCAGGCCGCCGGCAGCCACCTCAGCTCTCTGGGGGCT
GCTGCCGTGGCCCTCGTCCTGGCCGTGGCGGCTCTGTAG
Gene >Ophio5|8580
ATGCCATTCTCTACCGCCCAGCTCGTCACTCTCGCCGCGGCCGTGTCGTCGGCCTCGGCTACTTTCAGGGGTTTC
AACTATGGCGCTTTGAAGGGCTCGGTGCCCAAGACGCAAACCGATTTTGAGAACGAGTTCACGGCTGCCTCGGCT
CTACCGGGCACCGATGGCAAGTTCAGCAGTGCCCGTCTCTACACCATGATCGTATGTCGAAAACTGCCCACCCCC
TTTTACCGTCCGTGTTGTACACTCGCGCTTACACGTCCCCTATTTTAGCAAGGAGGCACTCCCAACGAACCCATC
TCCGCCATCCCAGCCGCCATCAAGTGCAAGACCAGCCTTCTGTTGGGTCTTTGGGCCTCAGCCGGCGAAGCCTCC
TTCGCCAACGAGATCGAGGCGCTCCGGAAGACAACCAAGCAGTACTGCAAGCAGCTCGACGGCCTGGTGGCCGGC
ATTTCCGTCGGCAGCGAGGATCTGTACCGTGAGACGCCGACGGGTAAGCAAAATAAGGAGTACGCGGGCACGAGC
CCCAAGACTCTCGTCAACTACATCCGGCAAACCAGGGAGGCCGTCAAGGGCACCTGTCTCGAAAAGGCACCGATC
GGTCACGTCGACACCTGGACGGCCTACGCCAACTCGTCCAACGAGGCCGTCTTCCCCGAACTCGACTGGCTCGGT
GTGGATGAATACCCCTACTACGAATATCAGAAGCCCAATGCGATCGAGGAGGCCGATAAGCTCTTCCACGCTGCC
ATCGACGAGGTCCAGAAGGTCATCAACAAGGGCGGCAAGAATCAGGAGATTTGGATCACCGAGATGGGCTGGCCC
GTCGAGGGAAAGACGACCGGTCAGGCTGTCGCGTCCAAGAAGAATGCCGAGTATTACTGGAAGAAGGTGGCCTGC
CCTACCTTTATCAAGAGGAACGTCTGGTACTACACTCTTCAGGATGGCGATGCCCAGAACAAGCCCAACCCTAGC
TTCGGTCTGGTCAACGACCTCAAGGGCAAGCCCCTGATTGACCTCTCCTGCAGTGGCTCGCAAGCGTCCAACAAG
TCCGAGTCGGATGAGACTGATGATTCCGGCAGCGGCTCTGGTGGCAAGGACAAATCGGCTTCCGGTAACGGCTCC
GGCGAAACGGACAAGTCTGGCTCTGGAAAGGAGTCCGAGTACGAGTCTGGTTCGAAGTGTACCTCTGGTCAATGC
TCTGGGTCGGACAAGAACTCTGGCTCGGGGTCCGACTACGGCTCCAGCTCGGGCAATGGCTCTGGCAAGTGTGCT
TCGGGTCAATGCTCCGGCTCCGGGGAGGGTCAGGGCTCCGACAACTACGGCTCCGGCTCTGGATCTGGTAAGGGC
TCCGATAACTACGGCTCCGGCTCTGAATCAGGCTCCGGCAAGGGCTCCGGCTCCGACAGCTACGGCTCTGGTTCC
AGCTCTGGCAAGGACTCCGACTCCGGCTCTAGCAAGGGCTCCGACAACTACGGCTCCGGCTCTGAATCGGGCTCC
GGCAAGAGCTCCGGCCCTGGATCCGAGACCAGCTCCGGCTCCGGATGTGGCTCCGGCCAATGCTCCGGCTCGAAC
CCCGCCCCCGCCGTGAGCACCCTGAGGTCCTATCCCTCCGGTGCGTCCAACTCCAGCGCCAACGGCAACGCTCCC
GGCTACGGCAACCAGCTCAGCCCCACGACCGTTGCCCAGGCCGCCGGCAGCCACCTCAGCTCTCTGGGGGCTGCT
GCCGTGGCCCTCGTCCTGGCCGTGGCGGCTCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail