Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8573
Gene name
Locationscaffold_98:17494..18768
Strand+
Gene length (bp)1274
Transcript length (bp)1170
Coding sequence length (bp)1167
Protein length (aa) 389

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily 3.0E-24 107 322

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8K1E6|ALKB3_MOUSE Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Mus musculus GN=Alkbh3 PE=1 SV=1 240 321 2.0E-06

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4393 0.9005 0.0737 0.0096 0.0926 0.017 0.0438 0.02 0.0886 0.0389

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3932
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|122
Ophiocordyceps australis map64 (Brazil) OphauB2|2755
Ophiocordyceps camponoti-floridani Ophcf2|04015
Ophiocordyceps camponoti-rufipedis Ophun1|1979
Ophiocordyceps kimflemingae Ophio5|8573 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7831

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8573
MESFLTRPKRSSDDAYDDEPTEVKIALLASLHPDVEQERLLEVLVSHRGSVDDSSAALQTKGKKASGVAGQQSSL
RTYGPRRKKVKAQKGSTLHLFDPEDVAEYTPCTIIHNFLPADEAEALLRELLAEAESFGRSSFKLFDNVVSSPHT
TAFFVDSLDEVRSQREEYYYNGSKLTREKERERQKLMGAGSSQDVRPITPQLAKVKPRVQEAVNRQVEHRIATRY
PGGRKLRYQPAEPWTANSAFVNCYRGGQESVGWHSDQLTYLGPRAVIGSISLGVAREFRVRRVVAVDDDAEEADS
GGAISIHLPHNSLLVMHAEMQESGEPANQHYVSRLSQGDASELDAEMRLRRAVRAEGGAEAEGESGKVFLDVPCW
ERAGQDAMFHVSLG
Coding >Ophio5|8573
ATGGAATCGTTTCTGACACGACCGAAGCGATCTTCGGATGACGCATACGATGACGAGCCCACCGAGGTCAAGATA
GCCCTCCTCGCCTCCCTCCACCCGGACGTCGAACAGGAAAGACTACTAGAGGTGCTGGTGTCGCACCGAGGATCC
GTCGACGACTCGTCGGCCGCACTACAAACAAAAGGCAAGAAAGCGAGCGGCGTCGCCGGACAGCAATCTTCGCTC
CGGACATACGGGCCTCGGAGAAAGAAGGTCAAGGCTCAAAAGGGGAGCACGCTGCACCTCTTCGATCCCGAAGAC
GTGGCGGAATACACGCCTTGCACCATCATCCACAACTTCTTACCGGCGGACGAGGCCGAAGCCTTGCTGCGTGAG
TTGTTGGCCGAGGCCGAGTCGTTTGGGAGGTCGAGCTTCAAGCTTTTTGATAATGTCGTCTCGAGCCCGCACACG
ACTGCGTTTTTCGTCGACAGCTTGGATGAGGTGCGGTCGCAGAGGGAGGAGTATTACTACAATGGATCTAAGCTG
ACGAGAGAGAAGGAGAGAGAGAGACAGAAGCTGATGGGGGCGGGCTCCTCGCAGGACGTGCGGCCCATCACCCCT
CAGCTGGCCAAGGTCAAGCCAAGGGTACAGGAGGCAGTCAACCGTCAAGTCGAGCACCGCATCGCGACGCGCTAC
CCGGGCGGACGTAAGCTTCGATACCAGCCTGCCGAGCCGTGGACTGCCAACTCTGCCTTTGTAAACTGCTACCGG
GGCGGACAGGAGAGCGTCGGATGGCACAGCGACCAGCTCACCTATCTCGGACCACGAGCTGTCATCGGATCCATC
TCTCTCGGCGTCGCGCGCGAGTTTCGCGTACGGCGCGTCGTTGCCGTCGATGACGACGCCGAAGAAGCAGACTCA
GGAGGAGCCATCTCGATTCACCTACCGCACAATTCGCTGCTGGTGATGCACGCCGAGATGCAAGAGTCCGGGGAA
CCGGCGAATCAACATTACGTATCGCGACTATCGCAAGGTGATGCATCCGAGCTCGACGCCGAGATGCGACTGCGG
CGTGCCGTGCGTGCTGAGGGTGGTGCAGAAGCGGAGGGAGAATCTGGGAAGGTATTTCTGGATGTGCCATGCTGG
GAACGTGCCGGGCAGGACGCCATGTTCCATGTTTCGCTGGGC
Transcript >Ophio5|8573
ATGGAATCGTTTCTGACACGACCGAAGCGATCTTCGGATGACGCATACGATGACGAGCCCACCGAGGTCAAGATA
GCCCTCCTCGCCTCCCTCCACCCGGACGTCGAACAGGAAAGACTACTAGAGGTGCTGGTGTCGCACCGAGGATCC
GTCGACGACTCGTCGGCCGCACTACAAACAAAAGGCAAGAAAGCGAGCGGCGTCGCCGGACAGCAATCTTCGCTC
CGGACATACGGGCCTCGGAGAAAGAAGGTCAAGGCTCAAAAGGGGAGCACGCTGCACCTCTTCGATCCCGAAGAC
GTGGCGGAATACACGCCTTGCACCATCATCCACAACTTCTTACCGGCGGACGAGGCCGAAGCCTTGCTGCGTGAG
TTGTTGGCCGAGGCCGAGTCGTTTGGGAGGTCGAGCTTCAAGCTTTTTGATAATGTCGTCTCGAGCCCGCACACG
ACTGCGTTTTTCGTCGACAGCTTGGATGAGGTGCGGTCGCAGAGGGAGGAGTATTACTACAATGGATCTAAGCTG
ACGAGAGAGAAGGAGAGAGAGAGACAGAAGCTGATGGGGGCGGGCTCCTCGCAGGACGTGCGGCCCATCACCCCT
CAGCTGGCCAAGGTCAAGCCAAGGGTACAGGAGGCAGTCAACCGTCAAGTCGAGCACCGCATCGCGACGCGCTAC
CCGGGCGGACGTAAGCTTCGATACCAGCCTGCCGAGCCGTGGACTGCCAACTCTGCCTTTGTAAACTGCTACCGG
GGCGGACAGGAGAGCGTCGGATGGCACAGCGACCAGCTCACCTATCTCGGACCACGAGCTGTCATCGGATCCATC
TCTCTCGGCGTCGCGCGCGAGTTTCGCGTACGGCGCGTCGTTGCCGTCGATGACGACGCCGAAGAAGCAGACTCA
GGAGGAGCCATCTCGATTCACCTACCGCACAATTCGCTGCTGGTGATGCACGCCGAGATGCAAGAGTCCGGGGAA
CCGGCGAATCAACATTACGTATCGCGACTATCGCAAGGTGATGCATCCGAGCTCGACGCCGAGATGCGACTGCGG
CGTGCCGTGCGTGCTGAGGGTGGTGCAGAAGCGGAGGGAGAATCTGGGAAGGTATTTCTGGATGTGCCATGCTGG
GAACGTGCCGGGCAGGACGCCATGTTCCATGTTTCGCTGGGCTGA
Gene >Ophio5|8573
ATGGAATCGTTTCTGACACGACCGAAGCGATCTTCGGATGACGCATACGATGACGAGCCCACCGAGGTCAAGATA
GCCCTCCTCGCCTCCCTCCACCCGGACGTCGAACAGGAAAGACTACTAGAGGTGCTGGTGTCGCACCGAGGATCC
GTCGACGACTCGTCGGCCGCACTACAAACAAAAGGCAAGAAAGCGAGCGGCGTCGCCGGACAGCAATCTTCGCTC
CGGACATACGGGCCTCGGAGAAAGAAGGTCAAGGCTCAAAAGGGGAGCACGCTGCACCTCTTCGATCCCGAAGAC
GTGGCGGAATACACGCCTTGCACCATCATCCACAACTTCTTACCGGCGGACGAGGCCGAAGCCTTGCTGCGTGAG
TTGTTGGCCGAGGCCGAGTCGTTTGGGAGGTCGAGCTTCAAGCTTTTTGATAATGTCGTCTCGAGCCCGCACACG
ACTGCGTTTTTCGTCGACAGCTTGGATGAGGTGCGGTCGCAGAGGGAGGAGTATTACTACAATGGATCTAAGCTG
ACGGTGTGTGTTGTTCCCCCGTCTTTGTGGTCCTTTTTGTGTGCGTGCGTGTGAGAGAGAGAGAAGGAGAGAGAG
AGACAGAAGCTGATGGGGGCGGGCTCCTCGCAGGACGTGCGGCCCATCACCCCTCAGCTGGCCAAGGTCAAGCCA
AGGGTACAGGAGGCAGTCAACCGTCAAGTCGAGCACCGCATCGCGACGCGCTACCCGGGCGGACGTAAGCTTCGA
TACCAGCCTGCCGAGCCGTGGACTGCCAACTCTGCCTTTGTAAACTGCTACCGGGGCGGACAGGAGAGCGTCGGA
TGGCACAGCGACCAGCTCACCTATCTCGGACCACGAGCTGTCATCGGATCCATCTCTCTCGGCGTCGCGCGCGAG
TTTCGCGTACGGCGCGTCGTTGCCGTCGATGACGACGCCGAAGAAGCAGACTCAGGAGGAGCCATCTCGATTCAC
CTACCGCACAATTCGCTGCTGGTGATGCACGCCGAGATGCAAGAGTCGTGGAAGCATTGCATCGCGCCCGCTCTG
GCCATCGATACTCATCCGGTAGCGGGGAACCGGCGAATCAACATTACGTATCGCGACTATCGCAAGGTGATGCAT
CCGAGCTCGACGCCGAGATGCGACTGCGGCGTGCCGTGCGTGCTGAGGGTGGTGCAGAAGCGGAGGGAGAATCTG
GGAAGGTATTTCTGGATGTGCCATGCTGGGAACGTGCCGGGCAGGACGCCATGTTCCATGTTTCGCTGGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail