Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8567
Gene name
Locationscaffold_98:2259..3830
Strand+
Gene length (bp)1571
Transcript length (bp)1383
Coding sequence length (bp)1380
Protein length (aa) 460

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03473 MOSC MOSC domain 3.8E-22 282 428
PF03476 MOSC_N MOSC N-terminal beta barrel domain 1.1E-13 78 147

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5VT66|MARC1_HUMAN Mitochondrial amidoxime-reducing component 1 OS=Homo sapiens GN=MARC1 PE=1 SV=1 78 398 3.0E-13
sp|O88994|MARC2_RAT Mitochondrial amidoxime reducing component 2 OS=Rattus norvegicus GN=Marc2 PE=2 SV=1 78 421 1.0E-12
sp|Q922Q1|MARC2_MOUSE Mitochondrial amidoxime reducing component 2 OS=Mus musculus GN=Marc2 PE=1 SV=1 78 421 4.0E-12
sp|Q9CW42|MARC1_MOUSE Mitochondrial amidoxime-reducing component 1 OS=Mus musculus GN=Marc1 PE=1 SV=2 78 393 5.0E-11
sp|Q5U534|MARC1_XENLA Mitochondrial amidoxime-reducing component 1 OS=Xenopus laevis GN=marc1 PE=2 SV=1 251 417 7.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5VT66|MARC1_HUMAN Mitochondrial amidoxime-reducing component 1 OS=Homo sapiens GN=MARC1 PE=1 SV=1 78 398 3.0E-13
sp|O88994|MARC2_RAT Mitochondrial amidoxime reducing component 2 OS=Rattus norvegicus GN=Marc2 PE=2 SV=1 78 421 1.0E-12
sp|Q922Q1|MARC2_MOUSE Mitochondrial amidoxime reducing component 2 OS=Mus musculus GN=Marc2 PE=1 SV=1 78 421 4.0E-12
sp|Q9CW42|MARC1_MOUSE Mitochondrial amidoxime-reducing component 1 OS=Mus musculus GN=Marc1 PE=1 SV=2 78 393 5.0E-11
sp|Q5U534|MARC1_XENLA Mitochondrial amidoxime-reducing component 1 OS=Xenopus laevis GN=marc1 PE=2 SV=1 251 417 7.0E-09
sp|Q9GKW0|MARC2_MACFA Mitochondrial amidoxime reducing component 2 OS=Macaca fascicularis GN=MARC2 PE=2 SV=1 78 421 1.0E-08
sp|Q58EJ9|MARC1_DANRE Mitochondrial amidoxime-reducing component 1 OS=Danio rerio GN=marc1 PE=2 SV=1 258 402 3.0E-07
sp|P75863|YCBX_ECOLI Uncharacterized protein YcbX OS=Escherichia coli (strain K12) GN=ycbX PE=1 SV=1 282 439 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0030170 pyridoxal phosphate binding Yes
GO:0030151 molybdenum ion binding Yes
GO:0003824 catalytic activity Yes
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0070279 vitamin B6 binding No
GO:0019842 vitamin binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8567
MDSGGGTPALATPGAIFALVITIIVFVLPIFIIFPPIPVERSDVLRQTHSKLGIRPHKSNLRTQHSAVHEAQAGR
PTTIQSLFIYPIKSCRGIELSRATVLPTGLENDRIFALAQRKPTPGVDADVGAWEVLTQRQMPLMANIKVDVWLP
DSSKKSRQLGKVEEPFVLVRFPWADRGPRRLVQLLAAKLSRGLRAVPEKEFILPLNYPSAQDVAALGYKHDAVKI
WKDTPSALNMERELPVELARYLGVRHRLAIFRMDPTRQREVFRCAPPKDSLGYQPIIDFHDAYPLHLLSLTSIRH
LESNIKKDESIQRLDARRFRGNIIISGAEAYDEDDWKSVRFKGGACRGNDASSVFDVSCRTVRCKLPNVDQATGV
RHRAEPDRAIRKYREVDPGAPKMGCLGMQLCPVFPQSETPEQLQSMLEVGMEVDVLQRGPHHYYWTDQKGERPEA
AQTEKAQHPP
Coding >Ophio5|8567
ATGGACTCCGGTGGGGGAACTCCGGCGCTGGCAACGCCTGGCGCCATCTTCGCACTCGTCATCACCATCATCGTC
TTTGTCCTCCCCATCTTCATCATTTTCCCACCCATTCCCGTTGAACGGAGCGACGTTCTACGTCAGACGCACAGC
AAGCTCGGCATACGCCCTCACAAGAGCAATCTTCGGACACAGCATTCGGCCGTCCATGAAGCGCAGGCCGGGCGA
CCGACGACGATACAGAGCCTGTTCATCTACCCCATCAAGTCTTGCCGTGGCATCGAGCTCTCGCGGGCGACGGTG
TTGCCCACTGGCCTTGAGAATGACCGCATCTTTGCCTTGGCCCAGCGCAAGCCAACGCCGGGAGTTGATGCTGAC
GTCGGCGCATGGGAGGTCCTCACGCAGAGGCAGATGCCGCTCATGGCCAACATCAAGGTCGACGTCTGGCTGCCT
GATTCAAGTAAGAAGAGCAGGCAGCTAGGCAAGGTGGAAGAGCCGTTTGTTCTCGTCCGTTTTCCCTGGGCCGAC
CGCGGTCCGAGACGGCTGGTGCAGCTGCTGGCGGCCAAGCTGAGCCGTGGCCTACGTGCCGTCCCCGAAAAGGAG
TTCATACTGCCTCTCAACTACCCGTCGGCCCAAGATGTGGCCGCTCTGGGATACAAGCACGACGCCGTCAAGATC
TGGAAAGACACGCCTTCAGCCCTCAACATGGAGCGGGAACTGCCGGTTGAGCTCGCCCGCTACCTCGGCGTGAGG
CACCGTCTGGCCATCTTCCGCATGGATCCTACGAGACAGAGAGAGGTGTTCCGTTGTGCGCCGCCCAAGGACTCG
CTCGGCTACCAGCCCATCATCGACTTCCACGACGCGTACCCTCTGCACTTGTTAAGCCTCACCAGCATCCGCCAT
CTCGAATCGAACATTAAAAAAGACGAATCTATCCAGCGTCTCGACGCTCGGAGGTTCAGAGGCAACATAATTATC
TCCGGCGCGGAAGCCTACGATGAGGACGACTGGAAGTCAGTTCGATTCAAGGGGGGCGCATGTAGGGGAAACGAC
GCGTCCAGCGTCTTTGACGTCTCGTGCCGCACCGTGCGGTGCAAACTGCCCAACGTCGACCAGGCCACTGGAGTT
CGCCACCGGGCCGAGCCAGACCGCGCCATCCGCAAATACCGCGAGGTCGATCCTGGCGCGCCTAAGATGGGCTGC
CTCGGCATGCAGCTCTGCCCGGTGTTCCCCCAGTCCGAGACGCCCGAGCAACTCCAGTCGATGCTTGAGGTGGGC
ATGGAGGTCGACGTCCTGCAACGGGGCCCTCACCACTACTACTGGACCGATCAAAAAGGGGAGAGACCTGAGGCG
GCGCAGACGGAAAAAGCACAGCATCCTCCC
Transcript >Ophio5|8567
ATGGACTCCGGTGGGGGAACTCCGGCGCTGGCAACGCCTGGCGCCATCTTCGCACTCGTCATCACCATCATCGTC
TTTGTCCTCCCCATCTTCATCATTTTCCCACCCATTCCCGTTGAACGGAGCGACGTTCTACGTCAGACGCACAGC
AAGCTCGGCATACGCCCTCACAAGAGCAATCTTCGGACACAGCATTCGGCCGTCCATGAAGCGCAGGCCGGGCGA
CCGACGACGATACAGAGCCTGTTCATCTACCCCATCAAGTCTTGCCGTGGCATCGAGCTCTCGCGGGCGACGGTG
TTGCCCACTGGCCTTGAGAATGACCGCATCTTTGCCTTGGCCCAGCGCAAGCCAACGCCGGGAGTTGATGCTGAC
GTCGGCGCATGGGAGGTCCTCACGCAGAGGCAGATGCCGCTCATGGCCAACATCAAGGTCGACGTCTGGCTGCCT
GATTCAAGTAAGAAGAGCAGGCAGCTAGGCAAGGTGGAAGAGCCGTTTGTTCTCGTCCGTTTTCCCTGGGCCGAC
CGCGGTCCGAGACGGCTGGTGCAGCTGCTGGCGGCCAAGCTGAGCCGTGGCCTACGTGCCGTCCCCGAAAAGGAG
TTCATACTGCCTCTCAACTACCCGTCGGCCCAAGATGTGGCCGCTCTGGGATACAAGCACGACGCCGTCAAGATC
TGGAAAGACACGCCTTCAGCCCTCAACATGGAGCGGGAACTGCCGGTTGAGCTCGCCCGCTACCTCGGCGTGAGG
CACCGTCTGGCCATCTTCCGCATGGATCCTACGAGACAGAGAGAGGTGTTCCGTTGTGCGCCGCCCAAGGACTCG
CTCGGCTACCAGCCCATCATCGACTTCCACGACGCGTACCCTCTGCACTTGTTAAGCCTCACCAGCATCCGCCAT
CTCGAATCGAACATTAAAAAAGACGAATCTATCCAGCGTCTCGACGCTCGGAGGTTCAGAGGCAACATAATTATC
TCCGGCGCGGAAGCCTACGATGAGGACGACTGGAAGTCAGTTCGATTCAAGGGGGGCGCATGTAGGGGAAACGAC
GCGTCCAGCGTCTTTGACGTCTCGTGCCGCACCGTGCGGTGCAAACTGCCCAACGTCGACCAGGCCACTGGAGTT
CGCCACCGGGCCGAGCCAGACCGCGCCATCCGCAAATACCGCGAGGTCGATCCTGGCGCGCCTAAGATGGGCTGC
CTCGGCATGCAGCTCTGCCCGGTGTTCCCCCAGTCCGAGACGCCCGAGCAACTCCAGTCGATGCTTGAGGTGGGC
ATGGAGGTCGACGTCCTGCAACGGGGCCCTCACCACTACTACTGGACCGATCAAAAAGGGGAGAGACCTGAGGCG
GCGCAGACGGAAAAAGCACAGCATCCTCCCTAG
Gene >Ophio5|8567
ATGGACTCCGGTGGGGGAACTCCGGCGCTGGCAACGCCTGGCGCCATCTTCGCACTCGTCATCACCATCATCGTC
TTTGTCCTCCCCATCTTCATCATTTTCCCACCCATTCCCGTTGAACGGAGCGACGTTCTACGTCAGACGCACAGC
AAGCTCGGCATACGCCCTCACAAGAGCAATCTTCGGACACAGCATTCGGCCGTCCATGAAGCGCAGGCCGGGCGA
CCGACGACGATACAGAGCCTGTTCATCTACCCCATCAAGTCTTGCCGTGGCATCGAGCTCTCGCGGGCGACGGTG
TTGCCCACTGGCCTTGAGAATGACCGCATCTTTGCCTTGGCCCAGCGCAAGCCAACGCCGGGAGTTGATGCTGAC
GTCGGCGCATGGGAGGTCCTCACGCAGAGGCAGATGCCGCTCATGGCCAACATCAAGGTCGACGTCTGGCTGCCT
GATTCAAGTAAGAAGAGCAGGCAGCTAGGCAAGGTGGAAGAGCCGTTTGTTCTCGTCCGTTTTCCCTGGGCCGAC
CGCGGTCCGAGACGGCTGGTGCAGCTGCTGGCGGCCAAGCTGAGCCGTGGCCTACGTGCCGTCCCCGAAAAGGAG
TTCATACTGCCTCTCAACTACCCGTCGGCCCAAGATGTGGCCGCTCTGGGATACAAGCACGACGCCGTCAAGATC
TGGAAAGACACGCCTTCAGCCCTCAACATGGAGCGGGAACTGCCGGTTGAGCTCGCCCGCTACCTCGGCGTGAGG
CACCGTCTGGCCATCTTCCGCATGGATCCTACGAGACAGAGAGAGGTGTTCCGTTGTGCGCCGCCCAAGGACTCG
CTCGGCTACCAGCCCATCATCGACTTCCACGACGCGGTACGTGCCAACCTTCTGTAGCCAGCCGTCTCCAAGACC
GCTCATTAACTCGTCTCCGCTCAGTACCCTCTGCACTTGTTAAGCCTCACCAGCATCCGCCATCTCGAATCGAAC
ATTAAAAAAGACGAATCTATCCAGCGTCTCGACGCTCGGAGGTTCAGAGGCAACATAATTAGTACGTGTTCGCGT
TCTGTCTGCCTCGTCATCCAGGAGCATTGAACTCCTCTAACGATGCTGTCTCCCGTAGTCTCCGGCGCGGAAGCC
TACGATGAGGACGACTGGAAGTCAGTTCGATTCAAGGGGGGCGCATGTAGGGGAAACGACGCGTCCAGCGTCTTT
GACGTCTCGTGCCGCACCGTGCGGTGAGTATGCTGAACTCTGACAGGCGTGGAATGACCAGGCTGACCACTTCAA
GGTGCAAACTGCCCAACGTCGACCAGGCCACTGGAGTTCGCCACCGGGCCGAGCCAGACCGCGCCATCCGCAAAT
ACCGCGAGGTCGATCCTGGCGCGCCTAAGATGGGCTGCCTCGGCATGCAGCTCTGCCCGGTGTTCCCCCAGTCCG
AGACGCCCGAGCAACTCCAGTCGATGCTTGAGGTGGGCATGGAGGTCGACGTCCTGCAACGGGGCCCTCACCACT
ACTACTGGACCGATCAAAAAGGGGAGAGACCTGAGGCGGCGCAGACGGAAAAAGCACAGCATCCTCCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail