Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8564
Gene name
Locationscaffold_978:53..2124
Strand-
Gene length (bp)2071
Transcript length (bp)2028
Coding sequence length (bp)2025
Protein length (aa) 675

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11915 DUF3433 Protein of unknown function (DUF3433) 1.4E-19 254 342
PF11915 DUF3433 Protein of unknown function (DUF3433) 1.1E-18 532 614

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 209 231 22
2 251 273 22
3 320 342 22
4 368 390 22
5 397 419 22
6 497 519 22
7 591 613 22
8 646 668 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8564
MVLDHGGGQPAPRHDGRPSWPGPLSYNSSRYAPVPTRSAAVEEHVDEEAYDLSLLSTAAPMAYDDGLPVFDVTSA
LGPLAAHDAEFIKKLQAQEASGTLTGGLGRGFSSMSSSSSSSSGAARVRVRDADLLRSSRPTSFRRRRSSQRQTI
RAAGQDEANRRGRIIEVIAEEDISNLDGGCDVRFHNTSSATRVFYPQPDWRPVSMRCTYLSMLVAVSVGLAVASE
LSYRTYGGRDRPLVRFTSASELRPSVYVAVRFAPSLCAVTYAVLWQLLDLDVRRLEAFHQLSRDGGSAAANSVNV
DYLTGYTLLRPLCALRRRHYAVVLSSLVAILAASLVPTLAVGSLVLTPGRAERRADPGMEKQLLLSDTWSRLLTA
TLVVCAVAGIVLLWILESRRSGLLADAQGIAGLASMAVVSHMLMDFKDLDTATHGDIHDRLKRKHYVLRNSSLAP
LDDDDDDDDDDDDDDDDCCAETWCRSDEVLDTKPSSMSPHPLILRPVGWLPFLASAVSFMAFIPAMLFTGADAIA
DRAPWAVTAVAVGLKLSWNAMETAVRVMEPFYILSRRHAPAKTLLLDYTVQPFGWLPVRALLNGHVLVFAVGLGS
VLTEFLTIFVSGLTMVDGHELISHHDSPTAGDTGQETPASFFASLAFSELILAYIFVVGVVVFVVVVVRKGRGRG
Coding >Ophio5|8564
ATGGTACTAGATCATGGAGGCGGCCAACCCGCACCTCGTCATGATGGCCGTCCGTCGTGGCCCGGTCCGCTCTCG
TACAACTCGTCGCGATACGCACCCGTGCCGACTCGGTCTGCGGCGGTCGAGGAACATGTCGACGAGGAGGCCTAC
GATCTGTCGCTTCTGTCCACTGCGGCGCCCATGGCCTACGATGATGGCCTGCCCGTCTTTGACGTTACCTCGGCC
TTGGGCCCTCTGGCCGCGCACGATGCTGAATTTATCAAGAAGCTTCAGGCTCAGGAGGCGAGTGGCACCTTGACT
GGAGGGCTGGGAAGGGGGTTTTCGTCCATGTCGTCGTCGTCGTCGTCGTCGTCCGGAGCGGCCCGGGTTCGAGTC
CGAGACGCGGACCTGCTTCGATCATCGCGACCGACATCGTTCCGGCGCCGACGGTCTTCGCAAAGACAGACGATC
CGCGCAGCTGGTCAGGACGAAGCCAACCGGCGCGGACGCATCATCGAGGTCATCGCCGAGGAAGACATCAGCAAT
CTCGATGGCGGATGCGACGTTCGCTTCCACAACACATCATCCGCTACCCGCGTCTTCTACCCGCAGCCCGATTGG
CGGCCCGTCTCCATGCGCTGCACCTATCTCTCCATGCTGGTCGCCGTCTCCGTCGGGCTGGCCGTCGCCTCCGAG
CTGTCGTATCGCACCTATGGCGGGAGAGACCGGCCCCTGGTGCGCTTCACTTCGGCCAGCGAGCTGCGGCCGAGC
GTGTACGTGGCGGTGCGATTTGCGCCTTCTCTGTGCGCTGTGACCTATGCAGTCTTGTGGCAGCTTCTCGATCTT
GACGTACGTCGACTCGAGGCCTTCCATCAGCTTTCGAGGGATGGCGGCTCGGCGGCGGCCAACTCGGTCAACGTC
GACTATCTCACGGGATATACACTGCTGCGACCGCTGTGCGCGCTGCGACGCCGCCATTACGCCGTCGTCCTGTCC
TCGCTGGTCGCCATCCTGGCTGCTTCGCTGGTGCCCACCTTGGCCGTCGGCTCTCTCGTATTGACACCCGGCAGG
GCTGAGCGCAGGGCCGATCCTGGCATGGAAAAGCAGCTGCTGCTGTCGGATACCTGGTCGCGCCTCCTGACAGCC
ACCTTGGTCGTCTGCGCCGTGGCCGGCATCGTCCTGCTGTGGATATTGGAGTCGAGACGTTCGGGCCTGCTAGCG
GACGCGCAGGGCATCGCAGGACTGGCCAGCATGGCCGTTGTCAGCCACATGCTCATGGACTTCAAGGATCTGGAT
ACGGCGACTCACGGAGATATACATGACCGTCTCAAGCGTAAACACTACGTCCTGCGCAACTCGTCTCTAGCGCCC
CTAGACGATGATGACGACGACGACGACGACGACGACGACGACGACGACGATTGTTGTGCCGAGACATGGTGCAGA
TCGGATGAGGTGCTCGACACGAAGCCGTCATCGATGAGCCCGCATCCTCTGATCCTCCGGCCGGTCGGTTGGCTC
CCTTTCCTGGCCAGCGCGGTGAGCTTCATGGCCTTCATACCGGCCATGCTCTTCACCGGCGCCGACGCGATTGCA
GATCGGGCGCCGTGGGCCGTCACCGCCGTCGCGGTTGGCCTCAAGCTCTCGTGGAACGCCATGGAAACGGCGGTG
CGGGTGATGGAGCCCTTTTATATCCTCTCGCGACGACACGCACCGGCCAAGACGTTGCTGCTCGACTACACCGTC
CAGCCGTTTGGATGGCTACCGGTGCGGGCGCTTCTCAACGGACATGTGCTCGTCTTCGCCGTAGGGCTCGGCAGC
GTACTGACCGAGTTCCTGACCATCTTCGTGTCGGGACTGACCATGGTCGACGGCCACGAGCTCATAAGCCACCAC
GACAGTCCTACCGCAGGGGACACGGGCCAGGAGACGCCAGCCTCATTCTTCGCCTCCCTCGCCTTTTCTGAACTG
ATTCTTGCCTACATCTTCGTCGTCGGCGTCGTCGTCTTCGTCGTCGTAGTCGTCAGGAAGGGAAGAGGACGAGGC
Transcript >Ophio5|8564
ATGGTACTAGATCATGGAGGCGGCCAACCCGCACCTCGTCATGATGGCCGTCCGTCGTGGCCCGGTCCGCTCTCG
TACAACTCGTCGCGATACGCACCCGTGCCGACTCGGTCTGCGGCGGTCGAGGAACATGTCGACGAGGAGGCCTAC
GATCTGTCGCTTCTGTCCACTGCGGCGCCCATGGCCTACGATGATGGCCTGCCCGTCTTTGACGTTACCTCGGCC
TTGGGCCCTCTGGCCGCGCACGATGCTGAATTTATCAAGAAGCTTCAGGCTCAGGAGGCGAGTGGCACCTTGACT
GGAGGGCTGGGAAGGGGGTTTTCGTCCATGTCGTCGTCGTCGTCGTCGTCGTCCGGAGCGGCCCGGGTTCGAGTC
CGAGACGCGGACCTGCTTCGATCATCGCGACCGACATCGTTCCGGCGCCGACGGTCTTCGCAAAGACAGACGATC
CGCGCAGCTGGTCAGGACGAAGCCAACCGGCGCGGACGCATCATCGAGGTCATCGCCGAGGAAGACATCAGCAAT
CTCGATGGCGGATGCGACGTTCGCTTCCACAACACATCATCCGCTACCCGCGTCTTCTACCCGCAGCCCGATTGG
CGGCCCGTCTCCATGCGCTGCACCTATCTCTCCATGCTGGTCGCCGTCTCCGTCGGGCTGGCCGTCGCCTCCGAG
CTGTCGTATCGCACCTATGGCGGGAGAGACCGGCCCCTGGTGCGCTTCACTTCGGCCAGCGAGCTGCGGCCGAGC
GTGTACGTGGCGGTGCGATTTGCGCCTTCTCTGTGCGCTGTGACCTATGCAGTCTTGTGGCAGCTTCTCGATCTT
GACGTACGTCGACTCGAGGCCTTCCATCAGCTTTCGAGGGATGGCGGCTCGGCGGCGGCCAACTCGGTCAACGTC
GACTATCTCACGGGATATACACTGCTGCGACCGCTGTGCGCGCTGCGACGCCGCCATTACGCCGTCGTCCTGTCC
TCGCTGGTCGCCATCCTGGCTGCTTCGCTGGTGCCCACCTTGGCCGTCGGCTCTCTCGTATTGACACCCGGCAGG
GCTGAGCGCAGGGCCGATCCTGGCATGGAAAAGCAGCTGCTGCTGTCGGATACCTGGTCGCGCCTCCTGACAGCC
ACCTTGGTCGTCTGCGCCGTGGCCGGCATCGTCCTGCTGTGGATATTGGAGTCGAGACGTTCGGGCCTGCTAGCG
GACGCGCAGGGCATCGCAGGACTGGCCAGCATGGCCGTTGTCAGCCACATGCTCATGGACTTCAAGGATCTGGAT
ACGGCGACTCACGGAGATATACATGACCGTCTCAAGCGTAAACACTACGTCCTGCGCAACTCGTCTCTAGCGCCC
CTAGACGATGATGACGACGACGACGACGACGACGACGACGACGACGACGATTGTTGTGCCGAGACATGGTGCAGA
TCGGATGAGGTGCTCGACACGAAGCCGTCATCGATGAGCCCGCATCCTCTGATCCTCCGGCCGGTCGGTTGGCTC
CCTTTCCTGGCCAGCGCGGTGAGCTTCATGGCCTTCATACCGGCCATGCTCTTCACCGGCGCCGACGCGATTGCA
GATCGGGCGCCGTGGGCCGTCACCGCCGTCGCGGTTGGCCTCAAGCTCTCGTGGAACGCCATGGAAACGGCGGTG
CGGGTGATGGAGCCCTTTTATATCCTCTCGCGACGACACGCACCGGCCAAGACGTTGCTGCTCGACTACACCGTC
CAGCCGTTTGGATGGCTACCGGTGCGGGCGCTTCTCAACGGACATGTGCTCGTCTTCGCCGTAGGGCTCGGCAGC
GTACTGACCGAGTTCCTGACCATCTTCGTGTCGGGACTGACCATGGTCGACGGCCACGAGCTCATAAGCCACCAC
GACAGTCCTACCGCAGGGGACACGGGCCAGGAGACGCCAGCCTCATTCTTCGCCTCCCTCGCCTTTTCTGAACTG
ATTCTTGCCTACATCTTCGTCGTCGGCGTCGTCGTCTTCGTCGTCGTAGTCGTCAGGAAGGGAAGAGGACGAGGC
TGA
Gene >Ophio5|8564
ATGGTACTAGATCATGGAGGCGGCCAACCCGCACCTCGTCATGATGGCCGTCCGTCGTGGCCCGGTCCGCTCTCG
TACAACTCGTCGCGATACGCACCCGTGCCGACTCGGTCTGCGGCGGTCGAGGAACATGTCGACGAGGAGGCCTAC
GATCTGTCGCTTCTGTCCACTGCGGCGCCCATGGCCTACGATGATGGCCTGCCCGTCTTTGACGTTACCTCGGCC
TTGGGCCCTCTGGCCGCGCACGATGCTGAATTTATCAAGAAGCTTCAGGCTCAGGAGGCGAGTGGCACCTTGACT
GGAGGGCTGGGAAGGGGGTTTTCGTCCATGTCGTCGTCGTCGTCGTCGTCGTCCGGAGCGGCCCGGGTTCGAGTC
CGAGACGCGGACCTGCTTCGATCATCGCGACCGACATCGTTCCGGCGCCGACGGTCTTCGCAAAGACAGACGATC
CGCGCAGCTGGTCAGGACGAAGCCAACCGGCGCGGACGCATCATCGAGGTCATCGCCGAGGAAGACATCAGCAAT
CTCGATGGCGGATGCGACGTTCGCTTCCACAACACATCATCCGCTACCCGCGTCTTCTACCCGCAGCCCGATTGG
CGGCCCGTCTCCATGCGCTGCACCTATCTCTCCATGCTGGTCGCCGTCTCCGTCGGGCTGGCCGTCGCCTCCGAG
CTGTCGTATCGCACCTATGGCGGGAGAGACCGGCCCCTGGTGCGCTTCACTTCGGCCAGCGAGCTGCGGCCGAGC
GTGTACGTGGCGGTGCGATTTGCGCCTTCTCTGTGCGCTGTGACCTATGCAGTCTTGTGGCAGCTTCTCGATCTT
GACGTACGTCGACTCGAGGCCTTCCATCAGCTTTCGAGGGATGGCGGCTCGGCGGCGGCCAACTCGGTCAACGTC
GACTATCTCACGGGATATACACTGCTGCGACCGCTGTGCGCGCTGCGACGCCGCCATTACGCCGTCGTCCTGTCC
TCGCTGGTCGCCATCCTGGCTGCTTCGCTGGTGCCCACCTTGGCCGTCGGCTCTCTCGTATTGACACCCGGCAGG
GCTGAGCGCAGGGCCGATCCTGGCATGGAAAAGCAGCTGCTGCTGTCGGATACCTGGTCGCGCCTCCTGACAGCC
ACCTTGGTCGTCTGCGCCGTGGCCGGCATCGTCCTGCTGTGGATATTGGAGTCGAGACGTTCGGGCCTGCTAGCG
GACGCGCAGGGCATCGCAGGACTGGCCAGCATGGCCGTTGTCAGCCACATGCTCATGGACTTCAAGGATCTGGAT
ACGGCGACTCACGGAGATATACATGACCGTCTCAAGCGTAAACACTACGTCCTGCGCAACTCGTCTCTAGCGCCC
CTAGACGATGATGACGACGACGACGACGACGACGACGACGACGACGACGATTGTTGTGCCGAGACATGGTGCAGA
TCGGATGAGGTGCTCGACACGAAGCCGTCATCGATGAGCCCGCATCCTCTGATCCTCCGGCCGGTCGGTTGGCTC
CCTTTCCTGGCCAGCGCGGTGAGCTTCATGGCCTTCATACCGGCCATGCTCTTCACCGGCGCCGACGCGATTGCA
GATCGGGCGCCGTGGGCCGTCACCGCCGTCGCGGTTGGCCTCAAGCTCTCGTGGAACGCCATGGAAACGGCGGTG
CGGGTGATGGAGCCCTTTTATATCCTCTCGCGACGACACGCACCGGCCAAGACGTTGCTGCTCGACTACACCGTC
CAGCCGTTTGGATGGCTACCGGTGCGGGCGCTTCTCAACGGACATGTGCTCGTCTTCGCCGTAGGGCTCGGCAGC
GTACTGACCGAGTTCCTGACCATCTTCGTGTCGGGACTGACCATGGTCGACGGCCACGAGCTCATAAGCCACCAC
GACAGTCCTACCGCAGGGGACACGGGCCAGGAGACGCCAGCCTCATTCTTCGCCTCCCTCGCCTTTTCTGAACTG
ATTCTTGCCTACATCTTCGTCGTCGGCGTCGTCGTCTTCGTCGTCGTAGTCGTCGTCATCGTCGTCGACGTCGTC
CATGGCCTGGGATTGAAGCTAGAGGAAGGGAAGAGGACGAGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail